DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10163 and PrBP

DIOPT Version :9

Sequence 1:NP_648042.1 Gene:CG10163 / 38728 FlyBaseID:FBgn0035697 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_609246.1 Gene:PrBP / 34196 FlyBaseID:FBgn0032059 Length:151 Species:Drosophila melanogaster


Alignment Length:111 Identity:23/111 - (20%)
Similarity:47/111 - (42%) Gaps:37/111 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 DARLHVMTITNQSV--ELPIKSISQIKDFDINPERKTLI-------------YVNAFHTADSYFS 130
            :||:.|..:..::|  |:...:|..:::|.:  ::|.|.             :|.| :|.:::.|
  Fly    47 EARVPVKILDMRAVSREINFSTIESMENFRL--DQKVLFKGRIMEEWFFEMGFVGA-NTTNTWQS 108

  Fly   131 VQE---------------HLTLLQNSRRDLNVIVVDFAKDVAQLYY 161
            ..|               ::| :|.|..|...::   .|.|.:|||
  Fly   109 TIEAAPESQMMPAKVLNGNVT-IQTSFYDNETLI---TKSVVRLYY 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10163NP_648042.1 Abhydrolase 91..349 CDD:304388 20/101 (20%)
PrBPNP_609246.1 GMP_PDE_delta 11..150 CDD:398820 21/109 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.845196 Normalized mean entropy S242
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.