DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10163 and CG17292

DIOPT Version :9

Sequence 1:NP_648042.1 Gene:CG10163 / 38728 FlyBaseID:FBgn0035697 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001285749.1 Gene:CG17292 / 34152 FlyBaseID:FBgn0032029 Length:340 Species:Drosophila melanogaster


Alignment Length:319 Identity:72/319 - (22%)
Similarity:137/319 - (42%) Gaps:59/319 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 LFQGINPSDARLHVMTITNQSVELPIKSISQIKDFDINPERKTLIY---------VNAFHT-ADS 127
            |:.|...:|:.::.:|        ..:|:.:.:..|:.  :.|::|         |.:.|. |::
  Fly    29 LYYGPTVADSDIYDLT--------DFQSLLEDEHLDLG--KNTVLYLHGYLEDPDVESIHVIAEA 83

  Fly   128 YFSVQEHLTLLQNSRRDLNVIVVDFAK--DVAQLYYAVRHHLSVNGYFVYKLLRALKDAGIAVQD 190
            |.           .|:|.|:||:|:.:  |...::.|. .:|...|..:.|:|..:.|.|:.::.
  Fly    84 YL-----------ERKDTNLIVLDWGELADGNYMFDAF-PNLKQLGPELAKVLLKMFDHGLDIEK 136

  Fly   191 ITLAGHSVGANIAALGAQLFAKENK--QLVGQLLAIDPATMCRTTDILVKQSVALRVVVLHGEGD 253
            ..:.|||:|..:|.|..:...|..|  :.:.::.|:|||.........:..:.|..|.|:|.:..
  Fly   137 FHIVGHSMGGQLAGLLGREITKRTKGVRKIKRISALDPAFPLFYPGTHLSANDAEFVDVIHTDAW 201

  Fly   254 VFGVRVPLGHIDIYPNGIGYFPRRKLQPGC---------ESKICSHMYPFILFMEALIEGVMI-- 307
            ::|.....|..|.:||| ||    .|||||         ::.:.||...:..:.|::.:...|  
  Fly   202 LYGAPTSTGTADFWPNG-GY----SLQPGCPKRNYKMLSDNDLSSHRRSWWFWAESVSDRYPIGF 261

  Fly   308 PATKCESWAKFRQG----DCNFQNTINIGLIYPANAKGLYFCMTQPNPPFTYMEHGLRY 362
            .|...:.|:.|:|.    :|   ..:.:|...|....|.::..|..:.||...:.|..|
  Fly   262 DAVPAKKWSDFKQNKIVENC---PPVVMGHHCPTTIHGDFYLQTNGHTPFARGKEGTVY 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10163NP_648042.1 Abhydrolase 91..349 CDD:304388 64/286 (22%)
CG17292NP_001285749.1 Pancreat_lipase_like 23..303 CDD:238363 67/303 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.