DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10163 and CG4267

DIOPT Version :9

Sequence 1:NP_648042.1 Gene:CG10163 / 38728 FlyBaseID:FBgn0035697 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001259919.1 Gene:CG4267 / 33405 FlyBaseID:FBgn0264979 Length:374 Species:Drosophila melanogaster


Alignment Length:327 Identity:75/327 - (22%)
Similarity:125/327 - (38%) Gaps:87/327 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 ELPIKSISQIKDFDINPERKTLIYVNAFHTADSYFSVQEHLTLLQNS---------------RRD 144
            ||.:..:..:::...:...:|.|.::.:.:.    |...|:..::|:               ..|
  Fly    87 ELFVGDVENLRNSGFDARHQTRIVIHGWMSQ----SKGSHIRKVKNAYLSLTDPGPNGEPAPYED 147

  Fly   145 LNVIVVDFAKDVAQL-YYAVRHHLSVNGYFVYKLLRAL-KDAGIAVQDITLAGHSVGANIAALGA 207
            .||||.|::|....: ||.|...:...|..:.:|:|.| ::|.:...|:.:.|||       |||
  Fly   148 FNVIVCDWSKTSTNVNYYEVAKTVEDMGALLAELVRYLNQEANMHYDDVYVIGHS-------LGA 205

  Fly   208 QLFAKENKQLV----GQLLAIDPA----------TMCRTTDILVKQSVALRVVVLHGEGDVFGVR 258
            |:.....||::    ..:.|:|||          .....:|....:|:...|        .||..
  Fly   206 QIAGSAGKQIMPYRFNTIYALDPAGPQFREKSDEYRIDASDASYVESIQTSV--------SFGFE 262

  Fly   259 VPLGHIDIYPNGIGYFPRRKLQPGCESKICSHMYPFILFMEALIEGVMIPATKCE-----SW--- 315
            .|:||...|||      ..|.|..|....|||......|:|:|.........:||     :|   
  Fly   263 QPVGHATFYPN------YGKNQKKCYVYGCSHKRSHDYFIESLTSPAGFWGPRCERHDDGTWLLL 321

  Fly   316 ---AKFRQGDCNFQNTINIGLIYPANAKGLYFCMTQPNPPFTYMEHGLRYKARRP------EKSS 371
               .:||.|.   :.:|      |.|  |.::..|...||:..   |.|::...|      |.|:
  Fly   322 MSDGEFRMGG---EPSI------PKN--GTFYVKTYSKPPYAM---GHRWQTEPPPREDDIENST 372

  Fly   372 EK 373
            |:
  Fly   373 EE 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10163NP_648042.1 Abhydrolase 91..349 CDD:304388 67/295 (23%)
CG4267NP_001259919.1 Lipase 64..351 CDD:278576 68/299 (23%)
Pancreat_lipase_like 71..347 CDD:238363 67/295 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445916
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.