DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10163 and CG5162

DIOPT Version :9

Sequence 1:NP_648042.1 Gene:CG10163 / 38728 FlyBaseID:FBgn0035697 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001285367.1 Gene:CG5162 / 32709 FlyBaseID:FBgn0030828 Length:411 Species:Drosophila melanogaster


Alignment Length:286 Identity:80/286 - (27%)
Similarity:119/286 - (41%) Gaps:41/286 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 FDINPERKTLIYVNAFHTADSYFSVQEHLTLLQNSRRDLNVIVVDFAKDVAQLYYAVRHHLSVNG 171
            ||:  ::|.:|....:.|..:.....|..:...|.|.|:|.:.||.|:.|..||.....:....|
  Fly   127 FDV--KKKVVILATGWTTTVNGSDTIEVFSKAYNCRGDVNFVAVDAARFVDTLYTWSAFNTEEIG 189

  Fly   172 YFVYKLLRALKDAGIAVQDITLAGHSVGANIAALGAQLFAKENKQLVGQLLAIDPATMCRTTDIL 236
            ..:...|..|.|. :.|::|.|.|||:||:|.....:.......|.:.::..:|||..|      
  Fly   190 ENIALGLVKLLDL-VPVENIHLIGHSLGAHIVGSAGRHLQHLTNQTIPRITGLDPAKPC------ 247

  Fly   237 VKQSVALR---------VVVLHGEGDVFGVRVPLGHIDIYPNGIGYFPRRKLQPGCESKICSHMY 292
            ..:..||.         |.|:|....|.|.|.|:|.:|.||.|:.     .|..||.|..|:|..
  Fly   248 FNEGEALSGLMRGDAHFVDVIHSNPGVLGKRDPVGDVDFYPGGMS-----PLAAGCFSVTCAHAR 307

  Fly   293 PFILFMEALIEG--VMIPATKCESWAKFRQGDCNFQNTINIGLIYPANAKGLYFCMTQPNPPF-- 353
            .:..|.|.:..|  ....||:|.|.:|.|...|. .:.:.:|...|.|.||.||.....:.||  
  Fly   308 SWEYFAETVFPGNERNFMATRCNSISKLRDFRCP-GDEVPMGYAVPQNIKGNYFLEVSASAPFGM 371

  Fly   354 -------TYMEH-GLRYKARRPEKSS 371
                   .::|| ||     .||.:|
  Fly   372 HASVVRSAHLEHCGL-----CPESTS 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10163NP_648042.1 Abhydrolase 91..349 CDD:304388 71/252 (28%)
CG5162NP_001285367.1 Lipase 94..369 CDD:278576 71/256 (28%)
Pancreat_lipase_like 99..365 CDD:238363 71/252 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446019
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007604
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.