DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10163 and Yp3

DIOPT Version :9

Sequence 1:NP_648042.1 Gene:CG10163 / 38728 FlyBaseID:FBgn0035697 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001285228.1 Gene:Yp3 / 32339 FlyBaseID:FBgn0004047 Length:420 Species:Drosophila melanogaster


Alignment Length:431 Identity:83/431 - (19%)
Similarity:152/431 - (35%) Gaps:97/431 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 MIIAVCLICQSLAV---EDKDKATNPLN----IDSVQKHNVKLLSEQLNRGWRAFCDAPVDEGVM 71
            |.:.:||:...|.|   ..||.:.:.|.    :.:.:..||..|::..   |....:.|:::|. 
  Fly     2 MSLRICLLATCLLVAAHASKDASNDRLKPTKWLTATELENVPSLNDIT---WERLENQPLEQGA- 62

  Fly    72 SLFQGI----------------NPSDARLHVMTITNQSVE------------------------- 95
            .:.:.|                :||:..:.::....|.||                         
  Fly    63 KVIEKIYHVGQIKHDLTPSFVPSPSNVPVWIIKSNGQKVECKLNNYVETAKAQPGFGEDEVTIVL 127

  Fly    96 --LPIKSISQIKDFDINPERKTLIYVNAFHTADSYFSVQEHLTLLQNSRRDL------------- 145
              ||..|.:|.|..    .|....||..::......:.||....|::|..|.             
  Fly   128 TGLPKTSPAQQKAM----RRLIQAYVQKYNLQQLQKNAQEQQQQLKSSDYDYTSSEEAADQWKSA 188

  Fly   146 -----NVIVVDFAKDVAQL-YYAVRHHLSVNGYFVYKLLRALKDAGIAVQDITLAGHSVGANIAA 204
                 ::|::|....:... .||:...|: .|..:.:.|..|.:.|:..:.|.|.|..:.|::|.
  Fly   189 KAASGDLIIIDLGSTLTNFKRYAMLDVLN-TGAMIGQTLIDLTNKGVPQEIIHLIGQGISAHVAG 252

  Fly   205 LGAQLFAKENKQLVGQLLAIDPA-TMCRTTDIL--VKQSVALRVVVLHGEGDVFGVRVPLGHIDI 266
            .....:..:....:.::..:||| .:.:...||  :.:..|..|..:|......|..:..|.:|.
  Fly   253 AAGNKYTAQTGHKLRRITGLDPAKVLSKRPQILGGLSRGDADFVDAIHTSTFAMGTPIRCGDVDF 317

  Fly   267 YPNGIGYFPRRKLQPGCESKICSHMYPFILFMEALIEGV--MIPATKCESWAKFRQGDCNFQNTI 329
            ||||    |...: ||.|:.|.:.......|.|::..|.  ..||....|..::::.| .|....
  Fly   318 YPNG----PSTGV-PGSENVIEAVARATRYFAESVRPGSERNFPAVPANSLKQYKEQD-GFGKRA 376

  Fly   330 NIGLIYPANAKGLYFCMTQPNPPFTYME--------HGLRY 362
            .:||....:.:|.|........||....        ||:.:
  Fly   377 YMGLQIDYDLRGDYILEVNAKSPFGQRSPAHKQAAYHGMHH 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10163NP_648042.1 Abhydrolase 91..349 CDD:304388 62/308 (20%)
Yp3NP_001285228.1 Lipase 93..400 CDD:278576 62/317 (20%)
Abhydrolase <215..396 CDD:304388 42/187 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438290
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007604
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.