DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10163 and lpl

DIOPT Version :9

Sequence 1:NP_648042.1 Gene:CG10163 / 38728 FlyBaseID:FBgn0035697 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_571202.1 Gene:lpl / 30354 ZFINID:ZDB-GENE-990415-139 Length:511 Species:Danio rerio


Alignment Length:277 Identity:79/277 - (28%)
Similarity:118/277 - (42%) Gaps:55/277 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 PSDARLHVMTITNQSVELPIKSISQIKDFDINPERKTLIYVNAFHTADSYFS-VQEHLTLLQNSR 142
            |.|...:::....||          |||.:.|.|.||.|.::.:.....:.| |.:.:|.|....
Zfish    68 PEDDLCYIVPGQPQS----------IKDCNFNTETKTFIVIHGWTVTGMFESWVPKLVTALYERE 122

  Fly   143 RDLNVIVVDFAKDVAQLYYAVRHHLSVNGYFVYKLLRALK-DAGIAVQDITLAGHSVGANIAALG 206
            ...||||||:.....|.|.....:..:.|..|.|.:..|: :.....:.:.|.|:|:||::|.:.
Zfish   123 PSANVIVVDWLSRAQQHYPTSASYTKLVGKDVAKFVNWLQAEIDYPWEKLHLLGYSLGAHVAGIA 187

  Fly   207 AQLFAKENKQLVGQLLAIDPA-TMCRTTDIL--VKQSVALRVVVLH----GEGD-VFGVRVPLGH 263
            ..|    .|..|.::..:||| ......|.|  :....|..|.|||    |..| ..|::.|:||
Zfish   188 GLL----TKHKVNRITGMDPAGPTFEYADSLSTLSPDDANFVDVLHTNTRGSPDRSIGIQRPVGH 248

  Fly   264 IDIYPNGIGYFPRRKLQPGCESK------------------ICSHMYPFILFMEALI----EGVM 306
            ||||||| |.|     ||||:.:                  .|||.....||:::|:    |.: 
Zfish   249 IDIYPNG-GTF-----QPGCDLQNTMLMVATTGLRNMDQIVKCSHERSIHLFIDSLVNQDHESM- 306

  Fly   307 IPATKCESWAKFRQGDC 323
              |.:|.|...|.:|.|
Zfish   307 --AFRCSSRDSFNKGMC 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10163NP_648042.1 Abhydrolase 91..349 CDD:304388 77/265 (29%)
lplNP_571202.1 lipo_lipase 52..492 CDD:132274 79/277 (29%)
Pancreat_lipase_like 56..353 CDD:238363 79/277 (29%)
PLAT 360..484 CDD:294016
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.