DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10163 and Lipi

DIOPT Version :9

Sequence 1:NP_648042.1 Gene:CG10163 / 38728 FlyBaseID:FBgn0035697 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001099369.1 Gene:Lipi / 288322 RGDID:1310162 Length:476 Species:Rattus norvegicus


Alignment Length:340 Identity:84/340 - (24%)
Similarity:124/340 - (36%) Gaps:106/340 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 KDKATNPLNIDSVQKHNVKLLSEQLNRGWRAFCDAPVDEGVMSLFQGINPSDARLHVMTITNQSV 94
            |..|.|.|.........:.||....|   .|.|..|       ||:..|..:||           
  Rat    42 KSNAMNSLKDLFYPTVKINLLMYSRN---NAKCAEP-------LFESNNSVNAR----------- 85

  Fly    95 ELPIKSISQIKDFDINPERKTLIYVNAF----------HTADSYFSVQEHLTLLQNSRRDLNVIV 149
                          .||.:||:..::.:          |.....|..||          |:|:||
  Rat    86 --------------FNPSKKTIWIIHGYRPLGSTPMWIHKFTKAFLKQE----------DVNLIV 126

  Fly   150 VDFAKDVAQLYY--AVRHHLSVNGYFVYKLLRA----LKDAGIAVQDITLAGHSVGANIAALGAQ 208
            ||:.:......|  ||:     |...|.::||.    |...|.::.:....|.|:||:|.....:
  Rat   127 VDWNQGATTFIYGRAVK-----NTRKVAEILREYIENLLIHGASLDNFHFIGMSLGAHICGFVGK 186

  Fly   209 LFAKENKQLVGQLLAIDPA--------TMCRT--TDILVKQSVALRVVVLHGEGDVFGVRVPLGH 263
            ||..:    :|::..:|||        :.||.  ||       |..|.|:|.:...||:..|.||
  Rat   187 LFQGQ----LGRITGLDPAGPKFSGKPSNCRLDYTD-------AKFVDVIHSDSQGFGILEPSGH 240

  Fly   264 IDIYPNGIGYFPRRKLQPGCESKI--------CSHMYPFILFMEALIEGVMIPATKCESWAKFRQ 320
            ||.||||      .:.||||.:.:        |.|.....||:||........:..|.|:..::.
  Rat   241 IDFYPNG------GRNQPGCPTSLLSGMDYIKCDHQRAVHLFLEAFETNCNFVSFPCRSYRDYKS 299

  Fly   321 GDCNFQNTINIGLIY 335
            |.|     :..|.:|
  Rat   300 GLC-----VGCGNLY 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10163NP_648042.1 Abhydrolase 91..349 CDD:304388 69/279 (25%)
LipiNP_001099369.1 Pancreat_lipase_like 57..346 CDD:238363 80/325 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338919
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.