DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10163 and Lipc

DIOPT Version :9

Sequence 1:NP_648042.1 Gene:CG10163 / 38728 FlyBaseID:FBgn0035697 Length:378 Species:Drosophila melanogaster
Sequence 2:XP_006243421.1 Gene:Lipc / 24538 RGDID:3009 Length:510 Species:Rattus norvegicus


Alignment Length:252 Identity:62/252 - (24%)
Similarity:101/252 - (40%) Gaps:44/252 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 LLQNSRRDLNVIVVDFAKDVAQLYYAVRHHLSVNGYFVYKLLRALKDA-GIAVQDITLAGHSVGA 200
            |.....:.:||.:||:.....|.|.....:..|.|..|..||..|::: ..:...:.|.|:|:||
  Rat   124 LKSRQSQPVNVGLVDWISLAYQHYAIAVRNTRVVGQEVAALLLWLEESMKFSRSKVHLIGYSLGA 188

  Fly   201 NIAALGAQLFAKENKQLVGQLLAIDPA-TMCRTTDILVKQSV-------ALRVVVLHGEGDVFGV 257
            :::.....  :...|:.:|::..:||| .|...|....:.|.       |:........|...|:
  Rat   189 HVSGFAGS--SMGGKRKIGRITGLDPAGPMFEGTSPNERLSPDDANFVDAIHTFTREHMGLSVGI 251

  Fly   258 RVPLGHIDIYPNGIGYFPRRKLQPGC------------------ESKICSHMYPFILFMEAL-IE 303
            :.|:.|.|.|||| |.|     ||||                  ::..|:|.....||:::| ..
  Rat   252 KQPIAHYDFYPNG-GSF-----QPGCHFLELYKHIAEHGLNAITQTIKCAHERSVHLFIDSLQHS 310

  Fly   304 GVMIPATKCESWAKFRQGDC-NFQNTINIGLIY------PANAKGLYFCMTQPNPPF 353
            .:.....:|.:...|.||.| |.:......|.|      |..:|.| |.:|:...||
  Rat   311 NLQNTGFQCSNMDSFSQGLCLNCKKGRCNSLGYDIRRDRPRKSKTL-FLITRAQSPF 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10163NP_648042.1 Abhydrolase 91..349 CDD:304388 60/246 (24%)
LipcXP_006243421.1 Lipase 18..366 CDD:278576 60/250 (24%)
Pancreat_lipase_like 47..362 CDD:238363 60/246 (24%)
PLAT_LPL 369..504 CDD:238856
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.