DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10163 and Pnliprp2

DIOPT Version :9

Sequence 1:NP_648042.1 Gene:CG10163 / 38728 FlyBaseID:FBgn0035697 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_035258.2 Gene:Pnliprp2 / 18947 MGIID:1336202 Length:482 Species:Mus musculus


Alignment Length:291 Identity:64/291 - (21%)
Similarity:116/291 - (39%) Gaps:68/291 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 NPSDARLHVMTITNQSVELPIKSISQIKDFDINP-----ERKTLIYVNAF----------HTADS 127
            :|.|.....:..||::.. ..:.||......||.     :|||...::.|          .....
Mouse    61 SPEDIDTRFLLYTNENPN-NYQIISATDPATINASNFQLDRKTRFIIHGFIDKGEEGWLLDMCKK 124

  Fly   128 YFSVQEHLTLLQNSRRDLNVIVVDFAKDVAQLYYAVRHHLSVNGYFVYKLLRALK-DAGIAVQDI 191
            .|.|::           :|.|.||:.:.....|....::..|.|..:..|::.|. :.|.:.:::
Mouse   125 MFQVEK-----------VNCICVDWKRGSRTEYTQASYNTRVVGAEIAFLVQVLSTEMGYSPENV 178

  Fly   192 TLAGHSVGANIAA-LGAQLFAKENKQLVGQLLAIDPATMC---RTTDILVKQSVALRVVVLHGEG 252
            .|.|||:|:::|. .|.:|     :..||::..:|||..|   ...::.:..|.|:.|.|:|.:.
Mouse   179 HLIGHSLGSHVAGEAGRRL-----EGHVGRITGLDPAEPCFQGLPEEVRLDPSDAMFVDVIHTDS 238

  Fly   253 DV------FGVRVPLGHIDIYPNGIGYFPRRKLQPGCESKI-------------------CSHMY 292
            ..      ||:...:||:|.:|||      .|..|||:..|                   |:|:.
Mouse   239 APIIPYLGFGMSQKVGHLDFFPNG------GKEMPGCQKNILSTIVDINGIWEGTRNFAACNHLR 297

  Fly   293 PFILFMEALIEGVMIPATKCESWAKFRQGDC 323
            .:..:..:::.........|.|:.||:..||
Mouse   298 SYKYYASSILNPDGFLGYPCSSYEKFQHNDC 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10163NP_648042.1 Abhydrolase 91..349 CDD:304388 61/278 (22%)
Pnliprp2NP_035258.2 Lipase 31..367 CDD:278576 64/291 (22%)
Pancreat_lipase_like 65..363 CDD:238363 62/287 (22%)
Required for galactolipase activity. /evidence=ECO:0000250|UniProtKB:P54317 106..118 1/11 (9%)
Required for galactolipase activity. /evidence=ECO:0000250|UniProtKB:P54317 270..292 1/21 (5%)
PLAT_PL 370..482 CDD:238857
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.