DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10163 and Lipc

DIOPT Version :9

Sequence 1:NP_648042.1 Gene:CG10163 / 38728 FlyBaseID:FBgn0035697 Length:378 Species:Drosophila melanogaster
Sequence 2:XP_006510879.1 Gene:Lipc / 15450 MGIID:96216 Length:526 Species:Mus musculus


Alignment Length:278 Identity:67/278 - (24%)
Similarity:110/278 - (39%) Gaps:63/278 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 ADSYFSVQEHLTLLQN----------SRRD--LNVIVVDFAKDVAQLYYAVRHHLSVNGYFVYKL 177
            :||.:.|.   .||:|          ||:.  :||.:||:.....|.|.....:..:.|..|..|
Mouse   103 SDSDYQVD---GLLENWIWKIVSALKSRQSQPVNVGLVDWISLAYQHYTIAVQNTRIVGQDVAAL 164

  Fly   178 LRALKD-AGIAVQDITLAGHSVGANIAALGAQLFAKENKQLVGQLLAIDPA-TMCRTTDILVKQS 240
            |..|:: |..:...:.|.|:|:||:::.........:||  :|::..:||| .|...|....:.|
Mouse   165 LLWLEESAKFSRSKVHLIGYSLGAHVSGFAGSSMDGKNK--IGRITGLDPAGPMFEGTSPNERLS 227

  Fly   241 V-------ALRVVVLHGEGDVFGVRVPLGHIDIYPNGIGYFPRRKLQPGC--------------- 283
            .       |:........|...|::.|:.|.|.|||| |.|     ||||               
Mouse   228 PDDANFVDAIHTFTREHMGLSVGIKQPIAHYDFYPNG-GSF-----QPGCHFLELYKHIAEHGLN 286

  Fly   284 ---ESKICSHMYPFILFMEAL----IEGVMIPATKCESWAKFRQGDC-----NFQNTINIGLIYP 336
               ::..|:|.....||:::|    ::.:   ..:|.....|.||.|     ...||:...:...
Mouse   287 AITQTIKCAHERSVHLFIDSLQHSDLQSI---GFQCSDMGSFSQGLCLSCKKGRCNTLGYDIRKD 348

  Fly   337 ANAKG-LYFCMTQPNPPF 353
            .:.|. ..|.:|:...||
Mouse   349 RSGKSKRLFLITRAQSPF 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10163NP_648042.1 Abhydrolase 91..349 CDD:304388 65/272 (24%)
LipcXP_006510879.1 Lipase 18..366 CDD:333880 65/276 (24%)
PLAT_LPL 369..504 CDD:238856
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.