DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10163 and Pnliprp2

DIOPT Version :9

Sequence 1:NP_648042.1 Gene:CG10163 / 38728 FlyBaseID:FBgn0035697 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_476554.1 Gene:Pnliprp2 / 117554 RGDID:620793 Length:482 Species:Rattus norvegicus


Alignment Length:313 Identity:67/313 - (21%)
Similarity:123/313 - (39%) Gaps:72/313 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 NRGWRAFCDAPVDEGVMSLFQGINPSDARLHVMTITNQS----VELPIKSISQIKDFDINPERKT 115
            ::.|......|     :.:|.. :|.|.....:..||::    .::.......||..:...:|||
  Rat    44 DKPWAGMLQRP-----LKIFPW-SPEDIDTRFLLYTNENPNNYQKISATEPDTIKFSNFQLDRKT 102

  Fly   116 LIYVNAF----------HTADSYFSVQEHLTLLQNSRRDLNVIVVDFAKDVAQLYYAVRHHLSVN 170
            ...|:.|          ......|.|::           :|.|.||:.:.....|....::..|.
  Rat   103 RFIVHGFIDKGEDGWLLDMCKKMFQVEK-----------VNCICVDWRRGSRTEYTQASYNTRVV 156

  Fly   171 GYFVYKLLRALK-DAGIAVQDITLAGHSVGANIAA-LGAQLFAKENKQLVGQLLAIDPATMC--- 230
            |..:..|::.|. :.|.:.:::.|.|||:||::.. .|.:|     :..||::..:|||..|   
  Rat   157 GAEIAFLVQVLSTEMGYSPENVHLIGHSLGAHVVGEAGRRL-----EGHVGRITGLDPAEPCFQG 216

  Fly   231 RTTDILVKQSVALRVVVLHGEGDV------FGVRVPLGHIDIYPNGIGYFPRRKLQPGCESKI-- 287
            ...::.:..|.|:.|.|:|.:...      ||:...:||:|.:|||      .|..|||:..|  
  Rat   217 LPEEVRLDPSDAMFVDVIHTDSAPIIPYLGFGMSQKVGHLDFFPNG------GKEMPGCQKNILS 275

  Fly   288 -----------------CSHMYPFILFMEALIEGVMIPATKCESWAKFRQGDC 323
                             |:|:..:..:..:::.........|.|:.||:|.||
  Rat   276 TIVDINGIWEGTQNFVACNHLRSYKYYASSILNPDGFLGYPCSSYEKFQQNDC 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10163NP_648042.1 Abhydrolase 91..349 CDD:304388 61/277 (22%)
Pnliprp2NP_476554.1 Lipase 31..367 CDD:278576 67/313 (21%)
Pancreat_lipase_like 65..363 CDD:238363 62/286 (22%)
PLAT_PL 370..482 CDD:238857
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.