DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mdr65 and LOC101883977

DIOPT Version :9

Sequence 1:NP_476831.1 Gene:Mdr65 / 38726 FlyBaseID:FBgn0004513 Length:1302 Species:Drosophila melanogaster
Sequence 2:XP_005174513.2 Gene:LOC101883977 / 101883977 -ID:- Length:257 Species:Danio rerio


Alignment Length:257 Identity:80/257 - (31%)
Similarity:115/257 - (44%) Gaps:41/257 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 GFIMCCIKALTLPAVVIIYSEFTSMLVDRAMQFGTSSNVHALPLFGGGKTLTN----------AS 105
            |.....:.....|.::::|...|:..|:        ..|..|.|....||..|          ..
Zfish     5 GSFCSLVHGAATPLMLLVYGMMTNTFVE--------YEVEILELTDPNKTCINNTISWMNGSAVQ 61

  Fly   106 REEN--------------NEALYDDSISYGILLTIASVVMFISGIFSVDVFNMVALRQVTRMRIK 156
            |.:|              |.|||...|..|:|         |...|.:..:...|.||:.|:|..
Zfish    62 RPDNTTIYCGVDIEAEMTNFALYYIGIGVGVL---------ILSFFQITFWVSAAARQIQRIRKT 117

  Fly   157 LFSSVIRQDIGWHDLASKQNFTQSMVDDVEKIRDGISEKVGHFVYLVVGFIITVAISFSYGWKLT 221
            .|..::|.:|||.|..|.......|.||:.||.:.|:::|..|:..:..||....:.|..|||||
Zfish   118 YFRKIMRMEIGWFDCNSVGELNTRMSDDINKINNAIADQVSIFIERISTFIFGFMVGFIGGWKLT 182

  Fly   222 LAVSSYIPLVILLNYYVAKFQGKLTAREQESYAGAGNLAEEILSSIRTVVSFGGEKSEVQRY 283
            |.|.:..||:.|....:|....:||.||.::||.||.:|:|:|||||||.:||||..|.:||
Zfish   183 LVVIAVSPLLGLAAGLMAMAVARLTGRELKAYAKAGAVADEVLSSIRTVAAFGGEHKEAERY 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mdr65NP_476831.1 PTZ00265 91..1300 CDD:240339 74/217 (34%)
ABC_membrane 108..354 CDD:279056 68/190 (36%)
ABC_MTABC3_MDL1_MDL2 405..642 CDD:213216
ABC_membrane 736..1006 CDD:279056
ABC_MTABC3_MDL1_MDL2 1059..1299 CDD:213216
LOC101883977XP_005174513.2 ABC_membrane 76..>244 CDD:279056 65/176 (37%)
MdlB 80..>255 CDD:224055 67/174 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D186078at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.