DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10226 and ABCB10

DIOPT Version :9

Sequence 1:NP_648040.1 Gene:CG10226 / 38725 FlyBaseID:FBgn0035695 Length:1320 Species:Drosophila melanogaster
Sequence 2:NP_036221.2 Gene:ABCB10 / 23456 HGNCID:41 Length:738 Species:Homo sapiens


Alignment Length:626 Identity:213/626 - (34%)
Similarity:335/626 - (53%) Gaps:70/626 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   722 PSANFISTFFRILGWARPE-------WSFLIIGAICAGLYGVTMPVF-SVVLAELYGSLAKPTDE 778
            |:|..:....::||.|.||       ..||.:.::.:    ::.|.| ..::..:|   ..||  
Human   149 PAAAGLPEARKLLGLAYPERRRLAAAVGFLTMSSVIS----MSAPFFLGKIIDVIY---TNPT-- 204

  Fly   779 EVLEQSASMAIISLVIGIAAGVVC-----YIQTFFFNLAGVWLTTRMRSKTFRCIMNQEMGWFDR 838
              ::.|.::.  .|.:|::|..:|     .|:.:....:|..:..|:|:..|..|:.||:.:||:
Human   205 --VDYSDNLT--RLCLGLSAVFLCGAAANAIRVYLMQTSGQRIVNRLRTSLFSSILRQEVAFFDK 265

  Fly   839 KENSIGALSARLSGDAASVQGAIGFPLSNIIQAFTNFICSIAIAFPYSWELALICLSTSPFMVAS 903
            ...  |.|..|||.|.|.:..::...||:.::|.......|::.|..|..||...||..|.:...
Human   266 TRT--GELINRLSSDTALLGRSVTENLSDGLRAGAQASVGISMMFFVSPNLATFVLSVVPPVSII 328

  Fly   904 IVFEARFGEKSALKEKEVLEETSRIATETITQIRTVAGLRREEELIKIYDKEVERY----RHQIL 964
            .|...|:..|.....::.|.:.:::|.|.|..:|||....:|...|:.|..:|:..    |.:..
Human   329 AVIYGRYLRKLTKVTQDSLAQATQLAEERIGNVRTVRAFGKEMTEIEKYASKVDHVMQLARKEAF 393

  Fly   965 SRLKWRGLVNSLGKSLMFFGYAVTLTYGG-------HMCADGKIKFETIMKISNTMLYGLFILAQ 1022
            :|..:.|.....|..::     :::.|.|       ||         |:.::|:.::|. |.:..
Human   394 ARAGFFGATGLSGNLIV-----LSVLYKGGLLMGSAHM---------TVGELSSFLMYA-FWVGI 443

  Fly  1023 SLAFTPAFNAALL----SANRMYEIIDRKPQIQSPESFEIQQNGNGTAYKTNVVQQGVSYRGLNF 1083
            |:....:|.:.|:    :..|::|:::|:|::...|         |........|..:.::.::|
Human   444 SIGGLSSFYSELMKGLGAGGRLWELLEREPKLPFNE---------GVILNEKSFQGALEFKNVHF 499

  Fly  1084 SYPSRPHIKVLQNFNLDINQGQTVALVGASGSGKSTCVQLLMRYYDPDEGKILIDQESIHHDMDL 1148
            :||:||.:.:.|:|:|.|..|...||||.|||||||.:.||:|.|||..|.|.:|...| ..::.
Human   500 AYPARPEVPIFQDFSLSIPSGSVTALVGPSGSGKSTVLSLLLRLYDPASGTISLDGHDI-RQLNP 563

  Fly  1149 KTLRRRLGIVSQEPSLFEKSIADNIGYG-DTSRQVPMQQIIEAAKMANAHEFIMSLPAQYDTVLG 1212
            ..||.::|.|||||.||..|||:||.|| |....|..::|...|::|||..||.:.|..::||:|
Human   564 VWLRSKIGTVSQEPILFSCSIAENIAYGADDPSSVTAEEIQRVAEVANAVAFIRNFPQGFNTVVG 628

  Fly  1213 SKGTQLSGGQKQRIAIARAMVRNPKILLLDEATSALDFQSERVVQQALDSACSGRTCIVIAHRLS 1277
            .||..||||||||||||||:::|||||||||||||||.::|.:||:|||....|||.:|||||||
Human   629 EKGVLLSGGQKQRIAIARALLKNPKILLLDEATSALDAENEYLVQEALDRLMDGRTVLVIAHRLS 693

  Fly  1278 TIQNANVICVIQAGKIVEQGSHSQLLAK-NGIYSKLYRCQT 1317
            ||:|||::.|:..|||.|.|.|.:||:| ||||.||...|:
Human   694 TIKNANMVAVLDQGKITEYGKHEELLSKPNGIYRKLMNKQS 734

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10226NP_648040.1 PTZ00265 81..1311 CDD:240339 210/618 (34%)
ABC_membrane <147..333 CDD:279056
ABC_MTABC3_MDL1_MDL2 414..649 CDD:213216
ABC_membrane 749..1019 CDD:279056 63/286 (22%)
ABC_MTABC3_MDL1_MDL2 1076..1316 CDD:213216 129/241 (54%)
ABCB10NP_036221.2 mitochondrial targeting sequence 1..105
PWWP 1..>26 CDD:295359
MdlB 163..734 CDD:224055 208/610 (34%)
ABC_membrane 177..438 CDD:279056 64/289 (22%)
ABC_MTABC3_MDL1_MDL2 493..733 CDD:213216 129/240 (54%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100059
Panther 1 1.100 - - O PTHR24221
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.