DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sf3b6 and AT5G12190

DIOPT Version :9

Sequence 1:NP_648037.1 Gene:Sf3b6 / 38720 FlyBaseID:FBgn0035692 Length:121 Species:Drosophila melanogaster
Sequence 2:NP_196780.1 Gene:AT5G12190 / 831092 AraportID:AT5G12190 Length:124 Species:Arabidopsis thaliana


Alignment Length:117 Identity:75/117 - (64%)
Similarity:95/117 - (81%) Gaps:0/117 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KRNHIRLPPEVNRLLYVRNLPYKITSDEMYDIFGKFGAIRQIRVGNTPETRGTAFVVYEDIFDAK 67
            ::::.||||||||:|||||||:.|||:||||||||:|||||||:|....|:||||||||||:|||
plant     7 RKSNTRLPPEVNRVLYVRNLPFNITSEEMYDIFGKYGAIRQIRIGCDKATKGTAFVVYEDIYDAK 71

  Fly    68 NACDHLSGFNVCNRYLVVLYYQSNKAFKRVDMDKKQEELNNIKAKYNLKTPE 119
            ||.||||||||.||||:|||||..|..|:.|..|.::|:..::.||.:.|.:
plant    72 NAVDHLSGFNVANRYLIVLYYQHAKMSKKFDQKKSEDEITKLQEKYGVSTKD 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sf3b6NP_648037.1 RRM_SF3B14 13..89 CDD:409687 60/75 (80%)
AT5G12190NP_196780.1 RRM_SF3B14 17..93 CDD:409687 60/75 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 116 1.000 Domainoid score I1984
eggNOG 1 0.900 - - E1_KOG0114
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9360
Inparanoid 1 1.050 165 1.000 Inparanoid score I1591
OMA 1 1.010 - - QHG54433
OrthoDB 1 1.010 - - D1603846at2759
OrthoFinder 1 1.000 - - FOG0005015
OrthoInspector 1 1.000 - - oto2850
orthoMCL 1 0.900 - - OOG6_102600
Panther 1 1.100 - - LDO PTHR12785
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3546
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.840

Return to query results.
Submit another query.