DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sf3b6 and AT2G14870

DIOPT Version :10

Sequence 1:NP_648037.1 Gene:Sf3b6 / 38720 FlyBaseID:FBgn0035692 Length:121 Species:Drosophila melanogaster
Sequence 2:NP_179093.1 Gene:AT2G14870 / 815976 AraportID:AT2G14870 Length:101 Species:Arabidopsis thaliana


Alignment Length:72 Identity:45/72 - (62%)
Similarity:58/72 - (80%) Gaps:1/72 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 NKRNHIRLPPEVNRLLYVRNLPYKITSDEMYDIFGKFGAIRQIRVGNTPETRGTAFVVYEDIFDA 66
            :|:|. ||||||.||||:.|||:.|||::.||:||::..|||:|:|....|:||||||||||:||
plant     8 DKQNP-RLPPEVTRLLYICNLPFSITSEDTYDLFGRYSTIRQVRIGCEKGTKGTAFVVYEDIYDA 71

  Fly    67 KNACDHL 73
            |.|.|||
plant    72 KKAVDHL 78

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sf3b6NP_648037.1 RRM_SF3B14 13..89 CDD:409687 38/61 (62%)
AT2G14870NP_179093.1 RRM_SF3B14 18..>78 CDD:409687 36/59 (61%)

Return to query results.
Submit another query.