DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sf3b6 and SF3B6

DIOPT Version :9

Sequence 1:NP_648037.1 Gene:Sf3b6 / 38720 FlyBaseID:FBgn0035692 Length:121 Species:Drosophila melanogaster
Sequence 2:NP_057131.1 Gene:SF3B6 / 51639 HGNCID:30096 Length:125 Species:Homo sapiens


Alignment Length:115 Identity:89/115 - (77%)
Similarity:105/115 - (91%) Gaps:0/115 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KRNHIRLPPEVNRLLYVRNLPYKITSDEMYDIFGKFGAIRQIRVGNTPETRGTAFVVYEDIFDAK 67
            ||.:|||||||||:||:||||||||::||||||||:|.||||||||||||||||:||||||||||
Human     7 KRANIRLPPEVNRILYIRNLPYKITAEEMYDIFGKYGPIRQIRVGNTPETRGTAYVVYEDIFDAK 71

  Fly    68 NACDHLSGFNVCNRYLVVLYYQSNKAFKRVDMDKKQEELNNIKAKYNLKT 117
            |||||||||||||||||||||.:|:||:::|..||:|:|..:|.||.:.|
Human    72 NACDHLSGFNVCNRYLVVLYYNANRAFQKMDTKKKEEQLKLLKEKYGINT 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sf3b6NP_648037.1 RRM_SF3B14 13..89 CDD:409687 68/75 (91%)
SF3B6NP_057131.1 Interaction with pre-mRNA branch site 16..29 10/12 (83%)
RRM_SF3B14 17..93 CDD:409687 68/75 (91%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159406
Domainoid 1 1.000 136 1.000 Domainoid score I4941
eggNOG 1 0.900 - - E1_KOG0114
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9360
Inparanoid 1 1.050 196 1.000 Inparanoid score I3819
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54433
OrthoDB 1 1.010 - - D1603846at2759
OrthoFinder 1 1.000 - - FOG0005015
OrthoInspector 1 1.000 - - oto91077
orthoMCL 1 0.900 - - OOG6_102600
Panther 1 1.100 - - LDO PTHR12785
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R931
SonicParanoid 1 1.000 - - X3546
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.