DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sf3b6 and sab14

DIOPT Version :9

Sequence 1:NP_648037.1 Gene:Sf3b6 / 38720 FlyBaseID:FBgn0035692 Length:121 Species:Drosophila melanogaster
Sequence 2:NP_595835.2 Gene:sab14 / 2540462 PomBaseID:SPBC29A3.07c Length:114 Species:Schizosaccharomyces pombe


Alignment Length:116 Identity:57/116 - (49%)
Similarity:84/116 - (72%) Gaps:10/116 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LPP-----EVNRLLYVRNLPYKITSDEMYDIFGKFGAIRQIRVGNTPETRGTAFVVYEDIFDAKN 68
            :||     |||.:|:::||.:|||::||||:||::|.:||||:|||.:||||||||||::.||:.
pombe     1 MPPSTVNQEVNSILFIKNLSFKITAEEMYDLFGRYGPVRQIRLGNTVQTRGTAFVVYENVQDARR 65

  Fly    69 ACDHLSGFNVCNRYLVVLYYQSNKAFKRV---DMDKKQEELNNIKAKYNLK 116
            ||:.|||:|..:|||||.||...:|  :|   |:..:...|..:|.||.::
pombe    66 ACEKLSGYNFMDRYLVVHYYNPERA--KVDGQDLAARYAALEQVKQKYGVQ 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sf3b6NP_648037.1 RRM_SF3B14 13..89 CDD:409687 46/75 (61%)
sab14NP_595835.2 RRM <2..>88 CDD:223796 50/85 (59%)
RRM_SF3B14 10..86 CDD:240687 46/75 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 99 1.000 Domainoid score I1858
eggNOG 1 0.900 - - E1_KOG0114
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 118 1.000 Inparanoid score I1523
OMA 1 1.010 - - QHG54433
OrthoFinder 1 1.000 - - FOG0005015
OrthoInspector 1 1.000 - - oto101817
orthoMCL 1 0.900 - - OOG6_102600
Panther 1 1.100 - - LDO PTHR12785
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R931
SonicParanoid 1 1.000 - - X3546
TreeFam 1 0.960 - -
1312.860

Return to query results.
Submit another query.