DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sf3b6 and sftb-6

DIOPT Version :9

Sequence 1:NP_648037.1 Gene:Sf3b6 / 38720 FlyBaseID:FBgn0035692 Length:121 Species:Drosophila melanogaster
Sequence 2:NP_493659.3 Gene:sftb-6 / 173394 WormBaseID:WBGene00016808 Length:138 Species:Caenorhabditis elegans


Alignment Length:115 Identity:81/115 - (70%)
Similarity:102/115 - (88%) Gaps:1/115 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 NKRNH-IRLPPEVNRLLYVRNLPYKITSDEMYDIFGKFGAIRQIRVGNTPETRGTAFVVYEDIFD 65
            |::|. .:|||||||:||::|||||||::|||:|||||||:||||||||.|||||||||||||||
 Worm     5 NRQNRGAKLPPEVNRILYIKNLPYKITTEEMYEIFGKFGAVRQIRVGNTAETRGTAFVVYEDIFD 69

  Fly    66 AKNACDHLSGFNVCNRYLVVLYYQSNKAFKRVDMDKKQEELNNIKAKYNL 115
            ||.||:||||:||.||||||||||:.||:||:|.:|.:.:|.:||.:|.:
 Worm    70 AKTACEHLSGYNVSNRYLVVLYYQATKAWKRMDTEKARTKLEDIKERYGI 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sf3b6NP_648037.1 RRM_SF3B14 13..89 CDD:409687 63/75 (84%)
sftb-6NP_493659.3 RRM <14..>96 CDD:223796 68/81 (84%)
RRM_SF3B14 17..93 CDD:240687 63/75 (84%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160167030
Domainoid 1 1.000 125 1.000 Domainoid score I3389
eggNOG 1 0.900 - - E1_KOG0114
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9360
Inparanoid 1 1.050 176 1.000 Inparanoid score I2696
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54433
OrthoDB 1 1.010 - - D1603846at2759
OrthoFinder 1 1.000 - - FOG0005015
OrthoInspector 1 1.000 - - oto19364
orthoMCL 1 0.900 - - OOG6_102600
Panther 1 1.100 - - LDO PTHR12785
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R931
SonicParanoid 1 1.000 - - X3546
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1615.800

Return to query results.
Submit another query.