DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7386 and plag1

DIOPT Version :9

Sequence 1:NP_648036.1 Gene:CG7386 / 38719 FlyBaseID:FBgn0035691 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_001034903.1 Gene:plag1 / 561450 ZFINID:ZDB-GENE-060302-2 Length:393 Species:Danio rerio


Alignment Length:240 Identity:68/240 - (28%)
Similarity:97/240 - (40%) Gaps:24/240 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 DEQAMGQRRIANDKRKLFRLMSCSICQQKFKKQSKFEEHMKHHNDLLPFQCQEESCRKGFTTAGA 239
            |...:.:||.....||.|   ||.:|::.|....|.:.|...|....|:.|....|.|.|.:...
Zfish    14 DHCRVRKRREEGKVRKNF---SCQLCEKAFNSLEKLKVHSYSHTGERPYHCTHTDCTKAFVSKYK 75

  Fly   240 LRLHVDYAHSKKEDTVPCTVEGCQLVFSRLRLLTIHLKKVHNQARVIAPRGEQ-SCKECGVVFRC 303
            |..|:  |....|.|..|:.  |:.:|.|    ..|||   |......|..|. ||.||...:..
Zfish    76 LLRHM--ATHSPEKTHKCSY--CEKMFHR----KDHLK---NHLHTHDPNKEAFSCTECDKSYNT 129

  Fly   304 PVAMKKHMYTHTGEELPYPCTICGKGFYINSALKNHLLRHAG-------IKNYVCQYCGVRKTTR 361
            .:..::|...|..:.....|.:|.:.:.....|..||..|||       .|.:.|..|..|..||
Zfish   130 KLGFRRHQALHAAQRGDLTCQVCLQSYPSTPLLLEHLRGHAGKSATATKEKRHQCDQCERRFYTR 194

  Fly   362 QEWSKHILIHTQRNQFKCRICDYATHTKRVLESHVK--IVHEKIR 404
            ::..:|:::||.|..|.|:.|......|..|..|||  ..||.:|
Zfish   195 KDVRRHLVVHTGRKDFLCQYCAQRFGRKDHLTRHVKKSHAHELLR 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7386NP_648036.1 zf-AD 10..81 CDD:214871
C2H2 Zn finger 197..217 CDD:275368 5/19 (26%)
C2H2 Zn finger 294..314 CDD:275368 4/19 (21%)
C2H2 Zn finger 323..343 CDD:275368 5/19 (26%)
C2H2 Zn finger 351..371 CDD:275368 6/19 (32%)
C2H2 Zn finger 379..400 CDD:275368 7/22 (32%)
C2H2 Zn finger 408..428 CDD:275368
C2H2 Zn finger 436..456 CDD:275368
C2H2 Zn finger 534..555 CDD:275368
C2H2 Zn finger 563..583 CDD:275368
zf-H2C2_2 575..600 CDD:290200
C2H2 Zn finger 591..611 CDD:275368
plag1NP_001034903.1 COG5048 29..>99 CDD:227381 21/76 (28%)
C2H2 Zn finger 33..53 CDD:275368 5/19 (26%)
C2H2 Zn finger 61..83 CDD:275368 7/23 (30%)
zf-H2C2_2 76..100 CDD:290200 8/27 (30%)
C2H2 Zn finger 91..111 CDD:275368 8/28 (29%)
C2H2 Zn finger 120..140 CDD:275368 4/19 (21%)
C2H2 Zn finger 149..169 CDD:275368 5/19 (26%)
C2H2 Zn finger 184..204 CDD:275368 6/19 (32%)
C2H2 Zn finger 212..230 CDD:275368 5/17 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24388
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.