DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7386 and CG1792

DIOPT Version :9

Sequence 1:NP_648036.1 Gene:CG7386 / 38719 FlyBaseID:FBgn0035691 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_651878.1 Gene:CG1792 / 43727 FlyBaseID:FBgn0039860 Length:372 Species:Drosophila melanogaster


Alignment Length:477 Identity:97/477 - (20%)
Similarity:168/477 - (35%) Gaps:139/477 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 CLTCLVHLKHGAGHDLFVVPD--LFQKLRACTSFDADQNDG--FPRNLCTQCFTKLNDLHDFREL 71
            |.||.:.:......:||..|:  :..::...|........|  .|..:|:.|...|.....||| 
  Fly     6 CRTCGLFIFCSTPSNLFEEPNSVMLHQIEVLTGLFLLGGPGNELPPFICSPCELDLQTAIAFRE- 69

  Fly    72 CAESIKRLKEMMTSQRNMPMGVFESIADDSEAPERPEEPASFDPLLNNKLEMIDNEEDVFKLLEK 136
                 :.::...|.|.:..:|..|.|...:...|:.                |...|:|.: :|.
  Fly    70 -----RVIRTQKTLQESPNLGNAELIESFAVGVEKE----------------IQYAEEVTE-IEV 112

  Fly   137 VDKELEEHSRDQSEEHFSSAEHNGLEEEKKESEGFNSDDEQAMGQRRIANDKRKLFRLMSCSICQ 201
            :|...|||..:::||.:                                            .||:
  Fly   113 IDLLPEEHLLEETEEPY--------------------------------------------EICE 133

  Fly   202 QKFKKQSKFEEHMKHHNDLLPFQCQEESCRKGFTTAGALRLHVDYAHSKKEDTVPCTVEGCQLVF 266
            |..:.|.|           :|  .||:..|:...|...:...|.:|.:.         :..:..:
  Fly   134 QNEQPQVK-----------VP--AQEKKLRRSTKTTPTVFTSVKFADNS---------QATRTQW 176

  Fly   267 SRLRLLTIHLKKVHNQARVIAPRGEQSCKECGVVFRCPVAMKKHMYTHTGEELPYPCTICGKGFY 331
            |||           .:..|:|.:.|:..::|                        .|..||:.|.
  Fly   177 SRL-----------TEDEVVALKRERRKRDC------------------------ICEQCGRHFT 206

  Fly   332 INSALKNHLLRHAGIKNYVCQYCGVRKTTRQEWSKHILIHTQRNQFKCRICD--YATHTKRVLES 394
            ..|..|.|||||.|:|::.|..|..:..|.....:|..:|.....|:||.|:  |:..:.|:  .
  Fly   207 CPSNFKLHLLRHTGVKSFACDQCSQQFYTATLLRRHQELHAGNALFQCRYCEATYSNASGRI--Q 269

  Fly   395 HVKIVHEKIRNFACQYCGKTFGKAYACKIHEMAHTGEKRCECKVCDKKFLHSESLNNHLK----I 455
            |.::.|..::.|.|:.|.|:|..:...:.|.::|||.:...|..|...|:....|.:|.:    .
  Fly   270 HERMRHTNVKPFTCKECNKSFAMSGKLRTHMLSHTGVRAFHCDSCQVSFVRRSHLTSHYRSKGHA 334

  Fly   456 HEKSVERALETYKQVQV---NG 474
            |..|.:.||:...::.|   ||
  Fly   335 HTSSAQAALDNPVELDVKASNG 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7386NP_648036.1 zf-AD 10..81 CDD:214871 15/73 (21%)
C2H2 Zn finger 197..217 CDD:275368 5/19 (26%)
C2H2 Zn finger 294..314 CDD:275368 1/19 (5%)
C2H2 Zn finger 323..343 CDD:275368 9/19 (47%)
C2H2 Zn finger 351..371 CDD:275368 4/19 (21%)
C2H2 Zn finger 379..400 CDD:275368 6/22 (27%)
C2H2 Zn finger 408..428 CDD:275368 5/19 (26%)
C2H2 Zn finger 436..456 CDD:275368 5/23 (22%)
C2H2 Zn finger 534..555 CDD:275368
C2H2 Zn finger 563..583 CDD:275368
zf-H2C2_2 575..600 CDD:290200
C2H2 Zn finger 591..611 CDD:275368
CG1792NP_651878.1 zf-AD 6..80 CDD:214871 16/79 (20%)
C2H2 Zn finger 198..218 CDD:275368 9/19 (47%)
C2H2 Zn finger 226..243 CDD:275368 3/16 (19%)
C2H2 Zn finger 254..275 CDD:275368 6/22 (27%)
zf-C2H2 281..303 CDD:278523 6/21 (29%)
C2H2 Zn finger 283..303 CDD:275368 5/19 (26%)
zf-H2C2_2 296..320 CDD:290200 7/23 (30%)
C2H2 Zn finger 311..329 CDD:275368 5/17 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24388
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.