DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7386 and ranshi

DIOPT Version :9

Sequence 1:NP_648036.1 Gene:CG7386 / 38719 FlyBaseID:FBgn0035691 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_649824.1 Gene:ranshi / 41041 FlyBaseID:FBgn0037620 Length:346 Species:Drosophila melanogaster


Alignment Length:464 Identity:104/464 - (22%)
Similarity:155/464 - (33%) Gaps:165/464 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 TCLVHLKHGAGHDLFVVPDLFQKLRACTSFDADQNDGFPRNLCTQCFTKLNDLHDFRELCAESIK 77
            |.|.|:|...|          ..|:.|::        .|..||..|.|.|.....|||.|.| ::
  Fly    28 TTLEHIKLLTG----------AVLKNCST--------LPNRLCASCQTCLQQAISFRERCLE-VQ 73

  Fly    78 RLKEMMTSQRNMPMGVFESIADDSEAPERPEEPASFDPLLNNKLEMIDNEEDVFKLLEKVDK--- 139
            |  |::.||                                       ::||..::.::..|   
  Fly    74 R--ELLHSQ---------------------------------------DDEDFLRICQESPKSVL 97

  Fly   140 ELEEHSRDQSEEHFSSAEHNGLEEEKKESEGFNSDDEQAMGQRRIANDKRKLFRLMSCSICQQKF 204
            |.||...|.:|........:.|.|...:|.||..:|        |.|                  
  Fly    98 EQEELELDLAEISIEVERLDDLNEGPIQSSGFKVED--------ILN------------------ 136

  Fly   205 KKQSKFEEHMKHHNDLLPFQCQEESCRKGFTTAGALRLHVDYAHSKKEDTVPCTVEGCQLVFSRL 269
              :||..|...::.|.:.:.                  .:||...:.:..|....|        |
  Fly   137 --ESKINEDEPNNEDDIDYS------------------EMDYLIYESDTEVDAKQE--------L 173

  Fly   270 RLLTIHLKKVHNQARVIAPRGEQS---CKECGVVFRCPVAMKKHMYTHTGEELPYPCTICGKGFY 331
            :..:.:.||..|:..   ||....   |:|||              .|..:.:.:..        
  Fly   174 KSDSENPKKRRNRRN---PRDSNRTFFCEECG--------------NHIKDRISFIL-------- 213

  Fly   332 INSALKNHLLRHAGIKNYVCQYCGVRKTTRQEWSKHILIHTQRNQFKCRIC-----DYATHTKRV 391
                   |..||.|:|.:.|::|..|..|..|..:||..||....||||.|     ||:|..|  
  Fly   214 -------HCKRHRGVKEFGCEFCEDRFCTPAELKRHIRKHTGEKPFKCRHCSRSFSDYSTRLK-- 269

  Fly   392 LESHVKIVHEKIRNFACQYCGKTFGKAYACKIHEMAHTGEKRCECKVCDKKFLHSESLNNHLK-- 454
               |.: .|...|.|.|:.|...|..:|..|.|.:.|||||...|.:|||.|.....|..|.:  
  Fly   270 ---HER-THTNERPFVCKECNNAFTTSYILKNHMLVHTGEKAFRCDLCDKLFSRYTHLTTHYRSN 330

  Fly   455 IHEKSVERA 463
            .|.:::::|
  Fly   331 AHRRNMQKA 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7386NP_648036.1 zf-AD 10..81 CDD:214871 19/67 (28%)
C2H2 Zn finger 197..217 CDD:275368 3/19 (16%)
C2H2 Zn finger 294..314 CDD:275368 4/19 (21%)
C2H2 Zn finger 323..343 CDD:275368 1/19 (5%)
C2H2 Zn finger 351..371 CDD:275368 7/19 (37%)
C2H2 Zn finger 379..400 CDD:275368 8/25 (32%)
C2H2 Zn finger 408..428 CDD:275368 6/19 (32%)
C2H2 Zn finger 436..456 CDD:275368 7/21 (33%)
C2H2 Zn finger 534..555 CDD:275368
C2H2 Zn finger 563..583 CDD:275368
zf-H2C2_2 575..600 CDD:290200
C2H2 Zn finger 591..611 CDD:275368
ranshiNP_649824.1 zf-AD 5..77 CDD:214871 20/69 (29%)
C2H2 Zn finger 198..218 CDD:275368 6/48 (13%)
COG5048 222..>276 CDD:227381 21/59 (36%)
C2H2 Zn finger 226..246 CDD:275368 7/19 (37%)
zf-H2C2_2 238..262 CDD:290200 10/23 (43%)
C2H2 Zn finger 254..274 CDD:275368 8/25 (32%)
zf-H2C2_2 269..291 CDD:290200 8/27 (30%)
C2H2 Zn finger 282..302 CDD:275368 6/19 (32%)
zf-H2C2_2 295..319 CDD:290200 12/23 (52%)
C2H2 Zn finger 310..328 CDD:275368 7/17 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24388
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.