DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7386 and CG8159

DIOPT Version :9

Sequence 1:NP_648036.1 Gene:CG7386 / 38719 FlyBaseID:FBgn0035691 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_649823.2 Gene:CG8159 / 41040 FlyBaseID:FBgn0037619 Length:399 Species:Drosophila melanogaster


Alignment Length:531 Identity:111/531 - (20%)
Similarity:178/531 - (33%) Gaps:148/531 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VQSLCLTCLVHLKHGAGHDLF--VVPDLFQKLRACTSFDADQNDGFPRNLCTQCFTKLNDLHDFR 69
            :|::|..|.....:.....||  ....:.|::...|........|.|..:|..|.|.|.....||
  Fly     2 LQNVCRVCASSTDNSKSLKLFNSGACKVLQQINLLTGVLLQCEPGLPDWMCETCQTDLKSAISFR 66

  Fly    70 ELCAESIKRLKEMMTSQRNMPMGVFESIADDSEAPERPEEPASFDPLLNNKLEMIDNEEDVFKLL 134
            :.|..|.|               :||.                         .::.||||.|:  
  Fly    67 DRCLRSQK---------------IFEE-------------------------SLVRNEEDTFR-- 89

  Fly   135 EKVDKELEEHSRDQSEEHFSSAEHNGLE--EEKKESEGFNSDDEQAMGQRRIANDKRKLFRLMSC 197
                ..:...:|.|.:.|..:|......  |...:.|..::.||:..|                 
  Fly    90 ----SSVRRSARSQRQRHEDTAPKTPASPLEVMIKLESLSNGDEEDDG----------------- 133

  Fly   198 SICQQKFKKQSKFEEHMKHHNDLLPFQCQEESCRKGFTTAGALRLHVDYAHSKKED---TVPCTV 259
                         .:|:             :||.:     ..:.|.:....|..||   |.|   
  Fly   134 -------------IDHL-------------DSCNE-----ADMELAIKAMSSSTEDDGTTSP--- 164

  Fly   260 EGCQLVFSRLRLLTIHLKKVHNQARVIAPRGEQSCKECGVVFRCPVAMKKHMYTHTGEELPYPCT 324
                          :.||:...:......:||...|....||.|..                   
  Fly   165 --------------VRLKRTRRRGLKKGGKGENRTKVTLPVFFCDQ------------------- 196

  Fly   325 ICGKGFYINSALKNHLLRHAGIKNYVCQYCGVRKTTRQEWSKHILIHTQRNQFKCRICD--YATH 387
             ||......|:...||.:|:||:.:.|:.|..|..:..|...|.::||...:|:||.||  |..:
  Fly   197 -CGNNITGKSSFDRHLRKHSGIRPFQCELCPARFLSSGELKGHQVMHTGDRKFQCRYCDRTYVNY 260

  Fly   388 TKRVLESHVKIVHEKIRNFACQYCGKTFGKAYACKIHEMAHTGEKRCECKVCDKKFLHSESLNNH 452
            :.|:....   .|...|.|.|..|||:|..:|..|.|.:.||||:...|::|.:.|.....|..|
  Fly   261 SGRLRHER---THTNDRPFICAQCGKSFTNSYILKNHMLIHTGERLFRCELCHRSFARPTHLKTH 322

  Fly   453 LK--IHEKSVERALETYKQVQVNGDASDTQVDSHQLLKVYAESVASIPKNPRRVEQ-VDVALLAG 514
            .:  .|:.::|:::.....||::...|..||......:..||:.|...:.|...|| .|.:|  |
  Fly   323 FRSNTHKHNLEKSMADAGGVQLSPSQSADQVKFVTEKEPEAEADAFTIEVPLPAEQEQDESL--G 385

  Fly   515 TAVNPTDEIQF 525
            .|...|..:.:
  Fly   386 LAALETSTLMY 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7386NP_648036.1 zf-AD 10..81 CDD:214871 17/72 (24%)
C2H2 Zn finger 197..217 CDD:275368 1/19 (5%)
C2H2 Zn finger 294..314 CDD:275368 4/19 (21%)
C2H2 Zn finger 323..343 CDD:275368 5/19 (26%)
C2H2 Zn finger 351..371 CDD:275368 5/19 (26%)
C2H2 Zn finger 379..400 CDD:275368 6/22 (27%)
C2H2 Zn finger 408..428 CDD:275368 8/19 (42%)
C2H2 Zn finger 436..456 CDD:275368 5/21 (24%)
C2H2 Zn finger 534..555 CDD:275368
C2H2 Zn finger 563..583 CDD:275368
zf-H2C2_2 575..600 CDD:290200
C2H2 Zn finger 591..611 CDD:275368
CG8159NP_649823.2 zf-AD 5..78 CDD:214871 18/87 (21%)
C2H2 Zn finger 194..214 CDD:275368 6/39 (15%)
COG5048 <197..322 CDD:227381 41/127 (32%)
zf-H2C2_2 206..231 CDD:290200 8/24 (33%)
C2H2 Zn finger 222..242 CDD:275368 5/19 (26%)
C2H2 Zn finger 250..270 CDD:275368 6/22 (27%)
zf-H2C2_2 265..287 CDD:290200 8/24 (33%)
C2H2 Zn finger 278..298 CDD:275368 8/19 (42%)
zf-H2C2_2 291..315 CDD:290200 9/23 (39%)
C2H2 Zn finger 306..328 CDD:275368 5/21 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24388
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.