DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7386 and CG11906

DIOPT Version :9

Sequence 1:NP_648036.1 Gene:CG7386 / 38719 FlyBaseID:FBgn0035691 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_611402.2 Gene:CG11906 / 37209 FlyBaseID:FBgn0034425 Length:634 Species:Drosophila melanogaster


Alignment Length:595 Identity:105/595 - (17%)
Similarity:199/595 - (33%) Gaps:180/595 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 LCTQCFTKLNDLHDFRELCAESIKRLKEMMTSQRNMPMGVFESIADDSEAPERPEEPASFDPLLN 118
            :|.:|..||| :|.  |:....::|::.:..|.     |....:...:.:|.:...|.: |..::
  Fly    88 ICVECVCKLN-MHS--EVTRSLMQRMQRLQRSG-----GETTKVTTTTTSPSQHSPPIA-DAEVS 143

  Fly   119 NKLEMIDNEEDVFKLLEKVDKE-----LEEHSRDQSEEHFSSAEHNGLEEEKKESEGFNSDDEQA 178
            ..|  |:::|:|....:.|...     ||.:...|  .:..||:    |.|:|.:||:       
  Fly   144 TTL--IESQEEVAHSGQSVRSRSSCSVLEVYLAQQ--PYSPSAK----ETEEKHAEGW------- 193

  Fly   179 MGQRRIANDKRKLFRLMSCSICQQKFKKQSKFEEHMKHHNDLLPFQCQEESCRKGFTTAGALRLH 243
                       |....:.|..|.:.:.::..:.:|::.             |.|           
  Fly   194 -----------KWRTRLECHECGRAYFRRDYYAQHLRR-------------CSK----------- 223

  Fly   244 VDYAHSKKEDTVPCTVEGCQLVFSRLRLLTIHLKKVHNQA--RVIAPRGEQSCKECGVVFRCPVA 306
                 ::::...|          ||::...::......:|  |.|.......|:.|...|...::
  Fly   224 -----TRRKQPRP----------SRVKCRVLNEASYDEEAPSRAIRSSRIYYCRHCDAEFETLIS 273

  Fly   307 MKKHMYTHTGEELPYPCTICGKGFYINSALKNHLLRHAGIKNYVCQYCGVRKTTRQEWSKHILIH 371
            .::|                            ..::|.  :.|.|..|..:..|:.||..|   |
  Fly   274 KRQH----------------------------ERMKHQ--QRYPCDLCEAQLDTKYEWEMH---H 305

  Fly   372 T--QRNQFKCRICDYATHTKRVLESHV-KIVHEKIRNFACQYCGKTFG---KAYACKIHEMAHTG 430
            |  |..|....|.:.....:.|:.|.| :....:.|:.||......:.   :....:..|:...|
  Fly   306 TICQAKQEALAIVEQQEAGQTVMTSRVPRACSMRSRSRACSEAWDRYDMDEEEEDEEDEEIESGG 370

  Fly   431 EKRCECKVCDKKFLHSESLN-------NHLKIHEKSVERALETYKQVQVNGD--------ASDTQ 480
            |   |.:..::..:::..:|       ||.:.:..|.......|      ||        .:|.:
  Fly   371 E---ELEEGEEDAMYARRMNFTGDWIVNHSRSNSNSAGNLSLLY------GDYGMVETHMTTDKE 426

  Fly   481 VDSH--QLLKVYAESVASIPKNPRRVEQVD--VALL--------------------AGTAVNPTD 521
            .|.:  .|||......:.....|....|.|  |||:                    ..|:....|
  Fly   427 YDLYLLDLLKTQVRLKSFTCFTPDCGYQTDTLVALMKHDYMEHWKMSWFYCHKCGDVFTSKVFLD 491

  Fly   522 EIQFVQKEGMYLCPSCSQGFKSIGNMKRHYKSVHEKVKDFECRFCSRRFANSQSVKQHEWIHTGE 586
            ....:|..|:|:|..|.:.|:....:.||:: :|.|..::.|.||...|.:...:..|       
  Fly   492 YHMHLQNRGLYICHKCREEFELQHQLDRHFQ-LHRKGINYHCNFCRLEFLSEAKLLAH------- 548

  Fly   587 KPFECKTCGN 596
                ||..|:
  Fly   549 ----CKKLGH 554

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7386NP_648036.1 zf-AD 10..81 CDD:214871 8/26 (31%)
C2H2 Zn finger 197..217 CDD:275368 3/19 (16%)
C2H2 Zn finger 294..314 CDD:275368 4/19 (21%)
C2H2 Zn finger 323..343 CDD:275368 0/19 (0%)
C2H2 Zn finger 351..371 CDD:275368 6/19 (32%)
C2H2 Zn finger 379..400 CDD:275368 4/21 (19%)
C2H2 Zn finger 408..428 CDD:275368 2/22 (9%)
C2H2 Zn finger 436..456 CDD:275368 3/26 (12%)
C2H2 Zn finger 534..555 CDD:275368 5/20 (25%)
C2H2 Zn finger 563..583 CDD:275368 5/19 (26%)
zf-H2C2_2 575..600 CDD:290200 4/22 (18%)
C2H2 Zn finger 591..611 CDD:275368 3/6 (50%)
CG11906NP_611402.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24388
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.