DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7386 and Zfp358

DIOPT Version :9

Sequence 1:NP_648036.1 Gene:CG7386 / 38719 FlyBaseID:FBgn0035691 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_001101798.1 Gene:Zfp358 / 360754 RGDID:1310416 Length:652 Species:Rattus norvegicus


Alignment Length:320 Identity:87/320 - (27%)
Similarity:124/320 - (38%) Gaps:73/320 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   293 SCKECGVVFRCPVAMKKHMYTHTGEELPYPCTICGKGFYINSALKNHLLRHAGIKNYVCQYCGVR 357
            ||.:||..||....:.:|..||:||: ||.|..|||.|...:.|..|...|.|.:.|.|..||..
  Rat   242 SCPDCGRAFRRSSGLSQHRRTHSGEK-PYRCPDCGKSFSHGATLAQHRGIHTGARPYQCAACGKA 305

  Fly   358 KTTRQEWSKHILIHTQRNQFKCRICDYATHTKRVLESHVKIVHEKIRNFACQYCGKTFGKAYACK 422
            ...|....||...|:......|.:|..|.....:|..|:: .|...|...|..|.|.||:..|..
  Rat   306 FGWRSTLLKHRSSHSGEKPHHCPVCGKAFGHGSLLAQHLR-THGGPRPHKCPVCAKGFGQGSALL 369

  Fly   423 IHEMAHTGEKRCECKVCDKKFLHSESLNNHLKIHEKSVERALETYKQVQVNGDASDTQVDSHQLL 487
            .|...||||:...|..|.|.|..|.:|..|.:.|                               
  Rat   370 KHLRTHTGERPYPCPQCGKAFGQSSALLQHQRTH------------------------------- 403

  Fly   488 KVYAESVASIPKNPRRVEQVDVALLAGTAVNPTDEIQFVQKEGMYLCPSCSQGFKSIGNMKRHYK 552
                                       ||..|            |.||.|.:.|....|::.|.:
  Rat   404 ---------------------------TAERP------------YRCPHCGKAFGQSSNLQHHLR 429

  Fly   553 SVHEKVKDFECRFCSRRFANSQSVKQHEWIHTGEKPFECKTCGNRFRQVAALIRHQKVHD 612
             :|...:.:.|..||:.|..|.::.||..:|:||:|:.|:.||..|.|.::|.:|::||:
  Rat   430 -IHTGERPYACPHCSKAFGQSSALLQHLHVHSGERPYRCQLCGKAFGQASSLTKHKRVHE 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7386NP_648036.1 zf-AD 10..81 CDD:214871
C2H2 Zn finger 197..217 CDD:275368
C2H2 Zn finger 294..314 CDD:275368 6/19 (32%)
C2H2 Zn finger 323..343 CDD:275368 7/19 (37%)
C2H2 Zn finger 351..371 CDD:275368 6/19 (32%)
C2H2 Zn finger 379..400 CDD:275368 5/20 (25%)
C2H2 Zn finger 408..428 CDD:275368 7/19 (37%)
C2H2 Zn finger 436..456 CDD:275368 7/19 (37%)
C2H2 Zn finger 534..555 CDD:275368 6/20 (30%)
C2H2 Zn finger 563..583 CDD:275368 7/19 (37%)
zf-H2C2_2 575..600 CDD:290200 10/24 (42%)
C2H2 Zn finger 591..611 CDD:275368 7/19 (37%)
Zfp358NP_001101798.1 COG5048 <236..429 CDD:227381 66/258 (26%)
zf-C2H2 241..263 CDD:278523 7/20 (35%)
C2H2 Zn finger 243..263 CDD:275368 6/19 (32%)
zf-H2C2_2 256..280 CDD:290200 12/24 (50%)
C2H2 Zn finger 271..291 CDD:275368 7/19 (37%)
zf-H2C2_2 284..306 CDD:290200 8/21 (38%)
C2H2 Zn finger 299..319 CDD:275368 6/19 (32%)
zf-H2C2_2 312..334 CDD:290200 5/21 (24%)
C2H2 Zn finger 327..347 CDD:275368 5/20 (25%)
zf-H2C2_2 340..362 CDD:290200 7/22 (32%)
C2H2 Zn finger 355..375 CDD:275368 7/19 (37%)
zf-H2C2_2 367..390 CDD:290200 9/22 (41%)
zf-C2H2_8 382..460 CDD:292531 26/148 (18%)
C2H2 Zn finger 383..403 CDD:275368 7/19 (37%)
zf-H2C2_2 395..418 CDD:290200 10/92 (11%)
C2H2 Zn finger 411..431 CDD:275368 6/20 (30%)
zf-H2C2_2 423..446 CDD:290200 6/23 (26%)
C2H2 Zn finger 439..459 CDD:275368 7/19 (37%)
zf-H2C2_2 451..474 CDD:290200 9/22 (41%)
zf-C2H2 465..487 CDD:278523 7/21 (33%)
C2H2 Zn finger 467..487 CDD:275368 7/19 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.