DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7386 and CG30431

DIOPT Version :9

Sequence 1:NP_648036.1 Gene:CG7386 / 38719 FlyBaseID:FBgn0035691 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_610211.1 Gene:CG30431 / 35549 FlyBaseID:FBgn0050431 Length:418 Species:Drosophila melanogaster


Alignment Length:485 Identity:118/485 - (24%)
Similarity:173/485 - (35%) Gaps:112/485 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LCLTCLV------HLKHGAGHDLFVVPDLFQKLRA-CTSFDADQNDGFPRNLCTQCFTKLNDLHD 67
            :|..||:      |..:.|...|.|      :|:| ..:...:..|.....:|..|..:|:|..|
  Fly    11 VCRCCLLEQPPLYHSLYDASSQLAV------ELKALAPALRLEHGDNLTDVICDLCLRRLHDARD 69

  Fly    68 FRELCAESIKRLKEMMTSQRNMPMGVFESIADDS--EAPERPEEPASFDPLLNNKLEMIDNEEDV 130
            |:..|..| :::..|........:.|.:::|.|.  |..||  |..|.:..::..|:.......|
  Fly    70 FQRRCEHS-EQVLRMRHEHWKHTVAVGDALALDDVLECLER--EVGSLEGPMSVPLQASKPVAHV 131

  Fly   131 FKLLEKVDKELEEHSRDQSEEH---------FSSAEHNGLEEEKKESEGF--------NSDDEQA 178
            ..|:|.||.|..:.......||         ..|...|....:.:.:|.|        .|.:|.|
  Fly   132 APLMETVDFESLDFQDSSHSEHDIPSYWESSVDSGSLNTPHHQPETAELFAVEPPTPPESSEEPA 196

  Fly   179 MGQRRIANDKRKLFRLMSCSICQQKFKKQSKFEEHMKHHNDLLPFQCQEESCRKGFTTAGALRLH 243
            ..    |.:|.|:.|...   .|...|.:.:......|...|.|  |.|  |.|.||....|:||
  Fly   197 PD----AAEKPKMRRARP---RQDNVKPKERKASGAVHPRSLHP--CPE--CEKKFTRNFQLKLH 250

  Fly   244 VDYAHSKKEDTVPCTVEGCQLVFSRLRLLTIHLKKVHNQARVIAPRGEQSCKECGVVFRCPVAMK 308
            :...|...|....|  |.|:..|:....|..|:|.||:..|   |.|   |:.|...|.....:.
  Fly   251 MTAVHGMGEMRYQC--EECRKNFASRHSLRYHVKSVHSTER---PFG---CQHCDRRFILRTQLL 307

  Fly   309 KHMYTHTGEELP--YPCTICGKGFYINSALKNHLLRHAGIKNYVCQYCGVRKTTRQEWSKHILIH 371
            .|:.|||||..|  :.|..|.|.:...|.|:.|:..|.                          .
  Fly   308 SHLRTHTGEAKPRIFECQRCSKSWPTKSDLRTHMRSHN--------------------------P 346

  Fly   372 TQRNQFKCRICDYATHTKRVLESHVKIVHEKIRNFACQYCGKTFGKAYACKIHEMAHTGEKRCEC 436
            .....|||..|..|..|:..|.||:                             :.|||||...|
  Fly   347 NMERPFKCDRCSKAFFTRGHLNSHL-----------------------------LVHTGEKPFAC 382

  Fly   437 KVCDKKFLHSESLNNHL-KIHEKSVERALE 465
            :.|||.:....:||||: ::|...:|..||
  Fly   383 EYCDKCYQSVGNLNNHMVRLHADIIEAQLE 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7386NP_648036.1 zf-AD 10..81 CDD:214871 18/77 (23%)
C2H2 Zn finger 197..217 CDD:275368 2/19 (11%)
C2H2 Zn finger 294..314 CDD:275368 4/19 (21%)
C2H2 Zn finger 323..343 CDD:275368 6/19 (32%)
C2H2 Zn finger 351..371 CDD:275368 0/19 (0%)
C2H2 Zn finger 379..400 CDD:275368 7/20 (35%)
C2H2 Zn finger 408..428 CDD:275368 0/19 (0%)
C2H2 Zn finger 436..456 CDD:275368 8/20 (40%)
C2H2 Zn finger 534..555 CDD:275368
C2H2 Zn finger 563..583 CDD:275368
zf-H2C2_2 575..600 CDD:290200
C2H2 Zn finger 591..611 CDD:275368
CG30431NP_610211.1 zf-AD 11..82 CDD:285071 18/77 (23%)
C2H2 Zn finger 234..255 CDD:275368 9/22 (41%)
C2H2 Zn finger 264..285 CDD:275368 7/22 (32%)
C2H2 Zn finger 293..313 CDD:275368 4/19 (21%)
zf-C2H2_8 305..373 CDD:292531 23/122 (19%)
C2H2 Zn finger 324..344 CDD:275368 6/19 (32%)
C2H2 Zn finger 354..374 CDD:275368 7/48 (15%)
zf-H2C2_2 366..389 CDD:290200 12/51 (24%)
C2H2 Zn finger 382..403 CDD:275368 8/20 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446651
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.