DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7386 and Cf2

DIOPT Version :9

Sequence 1:NP_648036.1 Gene:CG7386 / 38719 FlyBaseID:FBgn0035691 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_001350854.1 Gene:Cf2 / 33692 FlyBaseID:FBgn0000286 Length:537 Species:Drosophila melanogaster


Alignment Length:469 Identity:95/469 - (20%)
Similarity:166/469 - (35%) Gaps:138/469 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 CSICQQKFKKQSKFEEHM------------------------KHHNDLLP--FQCQEESCRKGFT 235
            |.:|.|:|::.....:||                        :.|..|..  |.|.|:     |.
  Fly    76 CPMCHQQFERPQHVADHMQLCHGITLNAQGAIATLDGGHPQAQQHPKLSHPCFNCDEK-----FG 135

  Fly   236 TAGALRLHVDYAHSKKEDTVPCTVEGCQLVFSRLRLLTIHLKKVHNQARVIAPRGEQSCKECGVV 300
            .|..|..|...||.     .|..:..|         |...:..:|:..:   ...|..|.:||.:
  Fly   136 NAVDLDEHHRLAHQ-----TPAFLSRC---------LMCSIYGIHSATQ---QPNEYKCTQCGSI 183

  Fly   301 FRCPVAM----------KKHMYTHTGEELPYPCTICGKGFYINSALKNHLLRHAGIKNYVCQYCG 355
              |..||          ::.......::||   .:..:...:....::|..:.....::..|:  
  Fly   184 --CTTAMLAAGQQGFMEQQEAAVTPDDQLP---AMAPRDMRLTPEEQHHQQQLQAEHHHQQQH-- 241

  Fly   356 VRKTTRQEWSKHILIHTQRNQFKCRICDYATHTKRVLESHVKIVHEKIRNFACQYCGKTFGKAYA 420
             ::..:|:..:..|:..|:.:.:.:......|       |    |::.::.|        |...|
  Fly   242 -QQQQQQQQQQQELLEQQQREMQEQAQQQQVH-------H----HQQDQDLA--------GDQVA 286

  Fly   421 CKIHEMAHTGEKRCECKVCDKKFLHSESLNNHLKIHEKSVERALETYKQVQVN------GDASDT 479
            .|:..:.                         :|:::.:...|:.::.||.:.      .|:.|.
  Fly   287 LKVPPLT-------------------------VKLNKNANGGAIVSHPQVIIKEEPLSLSDSGDV 326

  Fly   480 QVDSHQLLKVYAESVASIPKNPRRVEQVDVALLAGTAVNPTDEIQFVQKEGMYLCPSCSQGFKSI 544
             |:|   :.|||     |..||.........:|.||...|.|....::    :.||.|.:.||:.
  Fly   327 -VNS---VPVYA-----IQANPGVPAPASSGVLVGTQTVPADLAHKIR----HKCPDCPKTFKTP 378

  Fly   545 GNMKRHYKSVH-------EKVKDFECRFCSRRFANSQSVKQHEWIHTGEKPFECKTCGNRFRQVA 602
            |.:..|.| :|       .|.:.:.|.:|.:.|..|.::|||..||||||||.|..|...|....
  Fly   379 GTLAMHRK-IHTGEADATPKERPYTCSYCGKSFTQSNTLKQHTRIHTGEKPFHCGYCEKSFSVKD 442

  Fly   603 ALIRHQKVH-DEKP 615
            .|.:|.:.| .|||
  Fly   443 YLTKHIRTHTGEKP 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7386NP_648036.1 zf-AD 10..81 CDD:214871
C2H2 Zn finger 197..217 CDD:275368 6/43 (14%)
C2H2 Zn finger 294..314 CDD:275368 6/29 (21%)
C2H2 Zn finger 323..343 CDD:275368 1/19 (5%)
C2H2 Zn finger 351..371 CDD:275368 3/19 (16%)
C2H2 Zn finger 379..400 CDD:275368 2/20 (10%)
C2H2 Zn finger 408..428 CDD:275368 3/19 (16%)
C2H2 Zn finger 436..456 CDD:275368 1/19 (5%)
C2H2 Zn finger 534..555 CDD:275368 8/20 (40%)
C2H2 Zn finger 563..583 CDD:275368 7/19 (37%)
zf-H2C2_2 575..600 CDD:290200 14/24 (58%)
C2H2 Zn finger 591..611 CDD:275368 5/19 (26%)
Cf2NP_001350854.1 COG5048 <366..>473 CDD:227381 34/92 (37%)
C2H2 Zn finger 368..388 CDD:275368 8/20 (40%)
C2H2 Zn finger 403..423 CDD:275368 7/19 (37%)
C2H2 Zn finger 431..451 CDD:275368 5/19 (26%)
zf-H2C2_2 443..468 CDD:316026 6/14 (43%)
C2H2 Zn finger 459..480 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24388
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.