DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7386 and CG15436

DIOPT Version :9

Sequence 1:NP_648036.1 Gene:CG7386 / 38719 FlyBaseID:FBgn0035691 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_608840.1 Gene:CG15436 / 33657 FlyBaseID:FBgn0031610 Length:346 Species:Drosophila melanogaster


Alignment Length:428 Identity:97/428 - (22%)
Similarity:156/428 - (36%) Gaps:116/428 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 QKLRACTSFDADQNDGFPRNLCTQCFTKLNDLHDFRELCAESIK---RLKEMMTSQRNMPMGVFE 95
            :.:..||.|:..:.|.|...:|.||:..:...:..|:.|.||.:   |:::             |
  Fly    31 EMIAQCTGFEVKRGDLFSEMICPQCYEDVKSAYGIRQTCEESHQFYCRVRD-------------E 82

  Fly    96 SIADDSEAPERPEEPASFDPLLNNKLEMIDNEEDVFKLLEKVDKELEEHSRDQSEEHFSSAEHNG 160
            .|                             |:.:..|||:.|.|:.| ..|...:..|:|:.:|
  Fly    83 GI-----------------------------EDALCALLEEEDWEISE-DEDARIDSASAADDDG 117

  Fly   161 LEEEKKESEGFNSDDEQAMGQRRIANDKRKLFRLMSCSICQQKFKKQSKFEEHMKHHNDLLPFQC 225
            ..:.||.:                          ..|..|.:|::::..|..||:.|.|...|.|
  Fly   118 KSDSKKVA--------------------------FECRECHKKYQRKGTFLRHMRTHMDGQSFPC 156

  Fly   226 QEESCRKGFTTAGALRLHVDYAHSKKEDTVPCTVEGCQLVFSRLRLLTIHLKKVHNQARVIAPRG 290
              ..|::.|.....|:.|:                                 |.||.|:      
  Fly   157 --PYCKRNFRLRVTLKAHM---------------------------------KTHNAAK------ 180

  Fly   291 EQSCKECGVVFRCPVAMKKHMYTHTGEELPYPCTICGKGFYINSALKNHLLRHAGIKNYVCQYCG 355
            ...|..|...|.....::.|..|||||. |:.|:.|.|.|..:|.|:.|:..|...:.:.|..|.
  Fly   181 PYECSHCAKTFAQQSTLQSHERTHTGER-PFKCSQCSKTFIKSSDLRRHIRTHGSERPFKCSKCT 244

  Fly   356 VRKTTRQEWSKHILIHTQRNQFKCRICDYATHTKRVLESHVKIVHEKIRNFACQYCGKTFGKAYA 420
            ...|.:.....|...||....|||..|..|...|:.|:.|.:: |...|.|.|.:|.|||..:..
  Fly   245 KTFTRKFHLDNHFRSHTGERPFKCSHCPKAFAMKQHLKQHSRL-HLPDRPFRCSHCPKTFRLSST 308

  Fly   421 CKIHEMAHTGEKRCECKVCDKKFLHSESLNNH-LKIHE 457
            .|.|::.|..|:..:|..|...:...::|..| |:||:
  Fly   309 LKEHKLVHNAERTFKCPHCASFYKQRKTLARHILEIHK 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7386NP_648036.1 zf-AD 10..81 CDD:214871 13/49 (27%)
C2H2 Zn finger 197..217 CDD:275368 6/19 (32%)
C2H2 Zn finger 294..314 CDD:275368 4/19 (21%)
C2H2 Zn finger 323..343 CDD:275368 7/19 (37%)
C2H2 Zn finger 351..371 CDD:275368 4/19 (21%)
C2H2 Zn finger 379..400 CDD:275368 6/20 (30%)
C2H2 Zn finger 408..428 CDD:275368 7/19 (37%)
C2H2 Zn finger 436..456 CDD:275368 5/20 (25%)
C2H2 Zn finger 534..555 CDD:275368
C2H2 Zn finger 563..583 CDD:275368
zf-H2C2_2 575..600 CDD:290200
C2H2 Zn finger 591..611 CDD:275368
CG15436NP_608840.1 zf-AD 4..78 CDD:285071 12/46 (26%)
C2H2 Zn finger 128..148 CDD:275368 6/19 (32%)
C2H2 Zn finger 156..176 CDD:275368 6/54 (11%)
COG5048 <180..341 CDD:227381 47/168 (28%)
C2H2 Zn finger 184..204 CDD:275368 4/19 (21%)
zf-H2C2_2 197..219 CDD:290200 10/22 (45%)
C2H2 Zn finger 212..232 CDD:275368 7/19 (37%)
zf-H2C2_2 224..249 CDD:290200 5/24 (21%)
C2H2 Zn finger 240..260 CDD:275368 4/19 (21%)
zf-H2C2_2 252..276 CDD:290200 8/23 (35%)
C2H2 Zn finger 268..288 CDD:275368 6/20 (30%)
C2H2 Zn finger 296..316 CDD:275368 7/19 (37%)
C2H2 Zn finger 324..341 CDD:275368 3/16 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446538
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.