DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7386 and CG2120

DIOPT Version :9

Sequence 1:NP_648036.1 Gene:CG7386 / 38719 FlyBaseID:FBgn0035691 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_572446.2 Gene:CG2120 / 31737 FlyBaseID:FBgn0030005 Length:315 Species:Drosophila melanogaster


Alignment Length:410 Identity:95/410 - (23%)
Similarity:148/410 - (36%) Gaps:126/410 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 NDLHDFRELCAESIK---RLKEMMTSQRNMPMGVFESIADDSEAPERPEEPASFDPLLNNKLEMI 124
            :||.:: ::|.|.::   :|:::  |...:||                            ::|::
  Fly    18 DDLGNY-DVCLEDLQLFAQLEDL--SGERLPM----------------------------EMELL 51

  Fly   125 DNEEDVFKLLEKVDKELEEHSRDQSEEHFSSAEHNGLEEEKKESEGFNSDDEQAMGQRRIANDK- 188
             |....:.|||.|:..|::.         ::.||...:..|               .:|....| 
  Fly    52 -NPGSEYDLLELVNGALQQR---------NTTEHKPTDMCK---------------PKRTPTTKR 91

  Fly   189 -RKLFRLMSCSICQQKFKKQSKFEEHMKHHNDLLPFQCQEESCRKGFTTAGALRLHVDYAHSKKE 252
             |...:..:|.||.::|.:......|...|.|..|..|.|  |.|||.....||:|.        
  Fly    92 HRTTGKDHTCDICDRRFSEAYNLRIHKMTHTDEKPHVCVE--CGKGFRQLNKLRIHA-------- 146

  Fly   253 DTVPCTVEGCQLVFSRLRLLTIHLKKVHNQARVIAPRGEQSCKECGVVFRCPVAMKKHMYTHTGE 317
                               :|...::.|            .|..||..||....:..|...||||
  Fly   147 -------------------VTHTAERPH------------KCDICGKGFRYANYLTVHRRLHTGE 180

  Fly   318 ELPYPC--TICGKGFYINSALKNHL-LRHAGIKNYVCQYCGVRKTTRQEWSKHILIHTQRN---- 375
            : ||||  |.|...|:...|.:.|. ||||.             .|..:....:....||:    
  Fly   181 K-PYPCLATDCHLSFHSIHARRIHTKLRHAA-------------QTDPDPEHPLAEQEQRDTSAL 231

  Fly   376 QFKCRICDYATHTKRVLESHVKIVHEKIRNFACQY--CGKTFGKAYACKIHEMAHTGEKRCECKV 438
            .|.|.:|......:..|..|:| .|...|:|.|..  |||.|..|...|.|::|||.::...|.:
  Fly   232 SFTCPVCSRVLTDQCYLSIHLK-RHYNQRDFPCPQPECGKRFFSASELKHHQIAHTQQRPFACPL 295

  Fly   439 CDKKFLHSESLNNHLKIHEK 458
            |..:||...:...|||:||:
  Fly   296 CPARFLRKSNHKQHLKVHER 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7386NP_648036.1 zf-AD 10..81 CDD:214871 5/20 (25%)
C2H2 Zn finger 197..217 CDD:275368 5/19 (26%)
C2H2 Zn finger 294..314 CDD:275368 6/19 (32%)
C2H2 Zn finger 323..343 CDD:275368 7/22 (32%)
C2H2 Zn finger 351..371 CDD:275368 1/19 (5%)
C2H2 Zn finger 379..400 CDD:275368 5/20 (25%)
C2H2 Zn finger 408..428 CDD:275368 8/21 (38%)
C2H2 Zn finger 436..456 CDD:275368 7/19 (37%)
C2H2 Zn finger 534..555 CDD:275368
C2H2 Zn finger 563..583 CDD:275368
zf-H2C2_2 575..600 CDD:290200
C2H2 Zn finger 591..611 CDD:275368
CG2120NP_572446.2 C2H2 Zn finger 101..121 CDD:275368 5/19 (26%)
zf-H2C2_2 113..138 CDD:290200 10/26 (38%)
C2H2 Zn finger 129..149 CDD:275368 9/48 (19%)
zf-H2C2_2 142..166 CDD:290200 9/62 (15%)
COG5048 151..>264 CDD:227381 36/139 (26%)
C2H2 Zn finger 157..177 CDD:275368 6/19 (32%)
C2H2 Zn finger 185..206 CDD:275368 6/20 (30%)
C2H2 Zn finger 235..255 CDD:275368 5/20 (25%)
C2H2 Zn finger 263..285 CDD:275368 8/21 (38%)
C2H2 Zn finger 293..313 CDD:275368 7/19 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446553
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.