DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7386 and CG2116

DIOPT Version :9

Sequence 1:NP_648036.1 Gene:CG7386 / 38719 FlyBaseID:FBgn0035691 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_572444.2 Gene:CG2116 / 31735 FlyBaseID:FBgn0030003 Length:598 Species:Drosophila melanogaster


Alignment Length:602 Identity:122/602 - (20%)
Similarity:212/602 - (35%) Gaps:199/602 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 FVVPDLFQKLRACTSFDADQNDGFPRNLCTQ---CFTKLNDL-HDFRE--LCAESIKRLKEMMTS 85
            ||:|       |.:.:..:.|.|..|.:.|.   .:..|::| ::|.|  :........|||:.|
  Fly    14 FVLP-------ANSDYSDEDNRGNVRVINTSDDATYVLLDNLGNEFEEDIIIVNENGVEKEMLMS 71

  Fly    86 Q--RNMPMGV-FESIADDSEAPERPEEPASFDPLLNNKLEMIDNEEDVFKLLEKVDKELEEHSRD 147
            :  |:..:|. .:.:.||.:.|:          .:..:|:|    .:|..|:| |:.|:|:.: |
  Fly    72 KELRDFIVGSRVKDLTDDEQMPQ----------FVVRELDM----SEVGDLVE-VEPEMEQEA-D 120

  Fly   148 QSEEHFSSAEHNGLEEEKKESEGFNSDDE---------------------QAMGQRRIANDKRKL 191
            ..:  :...||.......:::|....|.:                     |...:.|  |..|: 
  Fly   121 YGD--YGDYEHEPSYGHPRDNERVEEDLDMYPPSSPSLPPSPPRPPSPVVQPASKAR--NSARQ- 180

  Fly   192 FRLMSCSICQQKFKKQSKFEEHMKHHNDLLPFQCQEESC---RKGFTTAGALRLHVDYAHSKKED 253
                   |..:.|..|...::......::.|.:...|..   |:.......:...||:    .||
  Fly   181 -------IALRSFVSQKNNDDDDGSVKEVKPSEKMLEEFKGPRRYMLFDDLIATIVDF----DED 234

  Fly   254 TVPCTVEGCQLVFSRLRLLTIHLKKVHNQARVIAPRGEQSCKECGVVFRCPVAM-----KKHMYT 313
            :.| .||     ||.:..:                ..|:...|||:   ||..|     .||..|
  Fly   235 STP-LVE-----FSMISDI----------------MDEKLPVECGI---CPDVMHKSKLSKHHKT 274

  Fly   314 HTGEELP----YPCTICGKGFYINSALKNHLLRHAGIKNYVCQYCGVRKTTRQEWSKHILIHTQR 374
            |.   :|    |.|..|.:.:.....|..|..||.||:.|||:.|.:..:|:|:    :.:|.||
  Fly   275 HL---VPGTNRYACIYCTETYRDCKYLAGHARRHMGIRPYVCELCTLYFSTKQD----LRVHNQR 332

  Fly   375 NQFK----CRIC--DYATHTKRVLESHVKIVHEKIRNFACQYCGKTFGKAYACKIH-EMAHTGEK 432
            ...:    |.:|  .:|.:|:  |:.|.:..|||.|.|.|:||.|.:.|.::.:.| ...|.|::
  Fly   333 RHLEKEHICEVCGKTFAQNTQ--LKRHREATHEKKRRFQCEYCQKAYYKNFSLQEHIRNVHMGKR 395

  Fly   433 R-CECKVCDKKFLHSESLNNHLKIHEKSVERALETYKQVQVNGDASDTQVDSHQLLKVYAESVAS 496
            | .:|..|..:...:..:..|.|                           :.|            
  Fly   396 RMLKCPFCGMQCRDAHKMARHRK---------------------------EMH------------ 421

  Fly   497 IPKNPRRVEQVDVALLAGTAVNPTDEIQFVQKEGMYLCPSCSQGFKSIGNMKRHYKSVHEKVKDF 561
                                          ..:|.|:|..|.:.|..|.....|.:|:       
  Fly   422 ------------------------------LSQGTYVCHLCQEEFTDISYFDAHKRSI------- 449

  Fly   562 ECRFCSRRFANSQSVKQ 578
            :||..:|||.|:...::
  Fly   450 QCRSNTRRFVNADGNRE 466

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7386NP_648036.1 zf-AD 10..81 CDD:214871 12/59 (20%)
C2H2 Zn finger 197..217 CDD:275368 3/19 (16%)
C2H2 Zn finger 294..314 CDD:275368 8/24 (33%)
C2H2 Zn finger 323..343 CDD:275368 4/19 (21%)
C2H2 Zn finger 351..371 CDD:275368 4/19 (21%)
C2H2 Zn finger 379..400 CDD:275368 6/22 (27%)
C2H2 Zn finger 408..428 CDD:275368 6/20 (30%)
C2H2 Zn finger 436..456 CDD:275368 4/19 (21%)
C2H2 Zn finger 534..555 CDD:275368 6/20 (30%)
C2H2 Zn finger 563..583 CDD:275368 6/16 (38%)
zf-H2C2_2 575..600 CDD:290200 0/4 (0%)
C2H2 Zn finger 591..611 CDD:275368
CG2116NP_572444.2 C2H2 Zn finger 256..275 CDD:275368 7/21 (33%)
C2H2 Zn finger 285..305 CDD:275368 4/19 (21%)
PHA00733 <308..357 CDD:177301 15/54 (28%)
C2H2 Zn finger 313..334 CDD:275368 7/24 (29%)
C2H2 Zn finger 341..362 CDD:275368 6/22 (27%)
C2H2 Zn finger 370..388 CDD:275368 6/17 (35%)
C2H2 Zn finger 400..418 CDD:275370 3/17 (18%)
C2H2 Zn finger 429..447 CDD:275368 5/17 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449764
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.