DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7386 and CG11398

DIOPT Version :9

Sequence 1:NP_648036.1 Gene:CG7386 / 38719 FlyBaseID:FBgn0035691 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_001259122.2 Gene:CG11398 / 31070 FlyBaseID:FBgn0040366 Length:329 Species:Drosophila melanogaster


Alignment Length:284 Identity:75/284 - (26%)
Similarity:109/284 - (38%) Gaps:59/284 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 EEDVFKLLEKV--DKELEEHSRD-QSEEHFSSAEHNGLEEEKKESEG-------------FNSDD 175
            |.::..||...  |:||..::.: |.||         |.|..:..:|             |.:.:
  Fly     8 EAEILALLPHTYEDEELSLNTEELQFEE---------LNERSQHQQGGSPSFVCRRCPALFLTRE 63

  Fly   176 EQAM---------GQRRIANDKRKLFRLMSCSICQQKFKKQSKFEEHMKHHNDLLPFQCQEESCR 231
            |.|.         ||:..|::.       :|..|.:.|:|.:...:||..|||:..:.|.|  |.
  Fly    64 ELAAHRPTHRYQGGQQTPASEH-------ACDACGRVFQKHNALVDHMNAHNDVRNYPCPE--CP 119

  Fly   232 KGFTTAGALRLHVDYAHSKKEDTVPCTVEGCQLVFSRLRLLTIHLKKVHNQARVIAPRGEQSCKE 296
            ..|........|:...| :|.....|...||:..|.:.|....|:|.||...|.:.      |..
  Fly   120 ARFVQRSNRECHLKNVH-RKVYLHSCPEPGCKKRFQQRRECDQHVKTVHQNERNLV------CDT 177

  Fly   297 CGVVFRCPVAMKKHMYTHTGEELPYPCTICGKGFYINSALKNHLLRHAGIKNYVCQYCGVRKTTR 361
            |...|..||..:||:.:| |....|.|.||||.|........||..|:..|.|:|..||.....|
  Fly   178 CSARFSHPVNYRKHLASH-GSAKSYGCPICGKLFGRPENRDVHLFVHSICKAYICSVCGADYMRR 241

  Fly   362 QEWSKHIL--------IHTQRNQF 377
            .:..:|.|        |..|:.||
  Fly   242 NQLIRHGLASGHHNDPIVRQKPQF 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7386NP_648036.1 zf-AD 10..81 CDD:214871
C2H2 Zn finger 197..217 CDD:275368 6/19 (32%)
C2H2 Zn finger 294..314 CDD:275368 7/19 (37%)
C2H2 Zn finger 323..343 CDD:275368 8/19 (42%)
C2H2 Zn finger 351..371 CDD:275368 6/27 (22%)
C2H2 Zn finger 379..400 CDD:275368
C2H2 Zn finger 408..428 CDD:275368
C2H2 Zn finger 436..456 CDD:275368
C2H2 Zn finger 534..555 CDD:275368
C2H2 Zn finger 563..583 CDD:275368
zf-H2C2_2 575..600 CDD:290200
C2H2 Zn finger 591..611 CDD:275368
CG11398NP_001259122.2 C2H2 Zn finger 52..72 CDD:275368 3/19 (16%)
C2H2 Zn finger 87..107 CDD:275368 6/19 (32%)
C2H2 Zn finger 115..136 CDD:275368 5/22 (23%)
C2H2 Zn finger 144..165 CDD:275368 6/20 (30%)
C2H2 Zn finger 175..195 CDD:275368 7/19 (37%)
C2H2 Zn finger 203..223 CDD:275368 8/19 (42%)
C2H2 Zn finger 231..247 CDD:275368 4/15 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449818
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.