DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment D19A and Sry-beta

DIOPT Version :9

Sequence 1:NP_477304.1 Gene:D19A / 38718 FlyBaseID:FBgn0022935 Length:845 Species:Drosophila melanogaster
Sequence 2:NP_001303451.1 Gene:Sry-beta / 43570 FlyBaseID:FBgn0003511 Length:356 Species:Drosophila melanogaster


Alignment Length:399 Identity:87/399 - (21%)
Similarity:128/399 - (32%) Gaps:133/399 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 NYDPLLNHKMELIENEEDVFKMLEHVDKEAEEVEKEAKVEEDDGGNVSVKMFDDDSSIESGNDND 181
            |||.|:.:..::.....|.......|:.:||..::.||     ...|.|..|             
  Fly    68 NYDRLVRNLSQVQRQIADALLGCRQVEGKAETKQQAAK-----RARVQVPAF------------- 114

  Fly   182 HDLDFEPNSSDDDIPLAQRMRGPATGSGPQQDRFSNLDKPKPRPRGRPKKIKPPPPEEEELSDSS 246
                        .|..|..::.|....| ::|......|                   ||:.|..
  Fly   115 ------------KIVQATALKEPERQPG-EEDECEEFMK-------------------EEMLDEE 147

  Fly   247 ---SESDDSEDGTSRGDKPKRKRIPIEERHLHRIIDCHICHQKFKKAIRYEEHMKYHNDLLPFQC 308
               ||.|||...:......:...||           ||||.:.|......|.|:           
  Fly   148 FQFSEPDDSMPSSEEEFFTETTEIP-----------CHICGEMFSSQEVLERHI----------- 190

  Fly   309 KVETCKKGFTTANGLRIHIDHAHTELSEVHACIAEGCGKTFPRVRLLTFHMKKVHGITKAAAPLR 373
            |.:||:|                   ||...|  ..||.......:|..||....|.|       
  Fly   191 KADTCQK-------------------SEQATC--NVCGLKVKDDEVLDLHMNLHEGKT------- 227

  Fly   374 DFPCTECDTVFRCPTALKKHMYKHTGEELPYPCNICGKRFVINSALRDHLMRHAGIKNH-VCPYC 437
            :..|..||..|.....:.:||..| .::..|.|:.||:||.::..:.:|||||...:|. :|..|
  Fly   228 ELECRYCDKKFSHKRNVLRHMEVH-WDKKKYQCDKCGERFSLSWLMYNHLMRHDAEENALICEVC 291

  Fly   438 GVGKTTRQEWNAHILTHTKEKKFKCRQCDHASHNKQALSNHVKVVHEKRKDFACQYCGKTFGKSH 502
            .....|::.:..|:.||         |.|                   |..:.|..|.|:|...:
  Fly   292 HQQFKTKRTYKHHLRTH---------QTD-------------------RPRYPCPDCEKSFVDKY 328

  Fly   503 ACKVHERSH 511
            ..|||:|.|
  Fly   329 TLKVHKRVH 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
D19ANP_477304.1 zf-AD 12..83 CDD:214871
C2H2 Zn finger 343..362 CDD:275368 5/18 (28%)
C2H2 Zn finger 377..397 CDD:275368 6/19 (32%)
zf-H2C2_2 389..414 CDD:290200 8/24 (33%)
C2H2 Zn finger 406..426 CDD:275368 8/19 (42%)
C2H2 Zn finger 434..454 CDD:275368 4/19 (21%)
C2H2 Zn finger 462..483 CDD:275368 2/20 (10%)
C2H2 Zn finger 491..511 CDD:275368 8/19 (42%)
C2H2 Zn finger 519..539 CDD:275368
C2H2 Zn finger 652..673 CDD:275368
C2H2 Zn finger 681..701 CDD:275368
zf-H2C2_2 694..718 CDD:290200
C2H2 Zn finger 709..729 CDD:275368
tolA_full 724..>814 CDD:274303
Sry-betaNP_001303451.1 C2H2 Zn finger 203..223 CDD:275368 6/21 (29%)
C2H2 Zn finger 231..251 CDD:275368 6/19 (32%)
C2H2 Zn finger 259..308 CDD:275368 15/48 (31%)
C2H2 Zn finger 288..303 CDD:275370 3/14 (21%)
zf-C2H2 315..337 CDD:278523 8/21 (38%)
C2H2 Zn finger 317..337 CDD:275368 8/19 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449777
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.