DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment D19A and CG5245

DIOPT Version :9

Sequence 1:NP_477304.1 Gene:D19A / 38718 FlyBaseID:FBgn0022935 Length:845 Species:Drosophila melanogaster
Sequence 2:NP_650197.1 Gene:CG5245 / 41530 FlyBaseID:FBgn0038047 Length:501 Species:Drosophila melanogaster


Alignment Length:581 Identity:145/581 - (24%)
Similarity:214/581 - (36%) Gaps:161/581 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   216 SNLDKPKPRPRGRPKKIKPPPPE--EEEL---SDSSSESDDS----EDGTSRG-DKPKRKRIP-- 268
            :|:|:       ||.|.:||..:  ||||   |:|..|..:|    |:..|.| |....|.:|  
  Fly     4 ANVDQ-------RPVKDEPPQEDTFEEELIFISNSDFEELESEIKIENFCSYGKDLEPVKGVPSK 61

  Fly   269 --------IEERHLHRIID---CHICHQKFKKAIRYEEHMKYHNDLLPFQCKVETCKKGFTTANG 322
                    .::|.|.:..|   |..|.:.|.:....|.|::.|.:..||:|  ..|.|.|    |
  Fly    62 LKTCKSKIAKKRPLRKQTDTFKCTQCQKTFTRKENLESHLRLHAEERPFEC--SHCSKSF----G 120

  Fly   323 LRIHID-HAHTELSEVHACIAEGCGKTFPRVRLLTFHMKKVHGITKAAAPLRDFPCTECDTVFRC 386
            .|.|.. |........|.|  ..|.|||.:...|..|:.:..|       .|.|.||:|.|.|..
  Fly   121 RRTHYKRHLLKHEKRPHKC--SHCSKTFTQNSSLKQHLHEHTG-------ERPFKCTQCSTSFAR 176

  Fly   387 PTALKKHMYKHTGEELPYPCNICGKRFVINSALRDHLMRHAGIKNHVCPYCGVGKTTRQEWNAHI 451
            .:.|:.|:..|: ||.|:.|..|.|.|..||.|::||..|...:...|.:|......|.....|:
  Fly   177 KSHLQVHLRTHS-EERPFECTHCEKAFKNNSHLQEHLRTHQEARPFKCSHCSKSFKLRSILQKHL 240

  Fly   452 LTHTKEKKFKCRQCDHASHNKQALSNHVKVVHEKRKDFACQYCGKTFGKS---------HACK-- 505
            |||. |:.|||.||........:|..|:: ||.....|.|.:|.:||.::         ||.|  
  Fly   241 LTHA-ERSFKCTQCPKTFLQNDSLQIHLR-VHAGEDPFKCPHCSETFARNSRLQLHLLEHAGKEP 303

  Fly   506 -----------------VHERSHTGEKCCECKICGKIFLCEKSLTKHLKTHEKRDLPPAEPLRQQ 553
                             ||.|.||.|:..:|..|.|.|..:..|.:|.:.|              
  Fly   304 LKCSQCSATFAMRSLYRVHVRLHTRERQYKCAECSKSFFKKSHLVEHQQVH-------------- 354

  Fly   554 LNIPMPGQMSVPMPGQMPMQMQTDGLVPMDPNQMPSEDMLKACGGGTAAVPPKPKNSRRVQRVDI 618
                         .|:.|.:                   ...|.        |....|...||.:
  Fly   355 -------------TGERPFK-------------------CTHCF--------KDFKCRTHLRVHM 379

  Fly   619 SQLAGTAVNPIPSVSVPSWSPQVNFTKKE-----------------GQHICPGCGRGFNNIGNMK 666
            ....|..|            |:.::..||                 .|..||.|.:.:.....:.
  Fly   380 LDHIGEKV------------PKCSYCSKEFKLSSQLLVHLQEHTGKNQFECPHCSKSYTTSSTLH 432

  Fly   667 LHYKIIHEKVKDFACRFCPKRFSKAQILRHHEWIHTGEKPFECKICGKHFRQETALKKHIK 727
            :|.: .|.....|.|..|.|.|:::...:.|...||||||::|..|...:.|:::|.:|::
  Fly   433 MHLR-THTGELPFKCSHCSKLFARSAEHQEHLRTHTGEKPYKCSHCSTRYTQKSSLGRHLR 492

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
D19ANP_477304.1 zf-AD 12..83 CDD:214871
C2H2 Zn finger 343..362 CDD:275368 6/18 (33%)
C2H2 Zn finger 377..397 CDD:275368 7/19 (37%)
zf-H2C2_2 389..414 CDD:290200 9/24 (38%)
C2H2 Zn finger 406..426 CDD:275368 9/19 (47%)
C2H2 Zn finger 434..454 CDD:275368 5/19 (26%)
C2H2 Zn finger 462..483 CDD:275368 5/20 (25%)
C2H2 Zn finger 491..511 CDD:275368 10/47 (21%)
C2H2 Zn finger 519..539 CDD:275368 6/19 (32%)
C2H2 Zn finger 652..673 CDD:275368 4/20 (20%)
C2H2 Zn finger 681..701 CDD:275368 5/19 (26%)
zf-H2C2_2 694..718 CDD:290200 9/23 (39%)
C2H2 Zn finger 709..729 CDD:275368 5/19 (26%)
tolA_full 724..>814 CDD:274303 1/4 (25%)
CG5245NP_650197.1 COG5048 74..478 CDD:227381 119/488 (24%)
C2H2 Zn finger 84..104 CDD:275368 5/19 (26%)
C2H2 Zn finger 112..132 CDD:275368 8/25 (32%)
C2H2 Zn finger 139..159 CDD:275368 7/21 (33%)
C2H2 Zn finger 167..187 CDD:275368 7/19 (37%)
zf-H2C2_2 179..204 CDD:290200 10/25 (40%)
C2H2 Zn finger 195..215 CDD:275368 9/19 (47%)
C2H2 Zn finger 223..243 CDD:275368 5/19 (26%)
C2H2 Zn finger 250..270 CDD:275368 5/20 (25%)
C2H2 Zn finger 278..298 CDD:275368 4/19 (21%)
C2H2 Zn finger 306..326 CDD:275368 3/19 (16%)
C2H2 Zn finger 334..354 CDD:275368 6/19 (32%)
C2H2 Zn finger 362..382 CDD:275368 5/27 (19%)
C2H2 Zn finger 390..410 CDD:275368 2/19 (11%)
C2H2 Zn finger 418..438 CDD:275368 4/20 (20%)
C2H2 Zn finger 446..466 CDD:275368 5/19 (26%)
C2H2 Zn finger 474..492 CDD:275368 5/17 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 138 1.000 Inparanoid score I1382
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.