DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment D19A and ouib

DIOPT Version :9

Sequence 1:NP_477304.1 Gene:D19A / 38718 FlyBaseID:FBgn0022935 Length:845 Species:Drosophila melanogaster
Sequence 2:NP_649822.2 Gene:ouib / 41039 FlyBaseID:FBgn0037618 Length:312 Species:Drosophila melanogaster


Alignment Length:499 Identity:95/499 - (19%)
Similarity:145/499 - (29%) Gaps:209/499 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IHSLCRIC---------LNHLQNDAAYDL----YLVPGLSKKLCFCTSLSVEQNDGFPKNLCTLC 60
            ::.:||:|         ||      .:||    ||     |.|...:.|.:...|..|..:|..|
  Fly     2 LNIVCRVCGRQKICEKSLN------LFDLVNRKYL-----KHLHMISGLRLVDLDDVPGFMCLCC 55

  Fly    61 YTKLNELHDFQKQCVDSVQKFQDLVASNVFACQSSFDVFDPNVAVQDYPAEEEDHVNYDPLLNHK 125
            ..:|.....|:|.|:.:..|:..:                           |:|..:.|...|..
  Fly    56 QAELRSALAFRKLCIKTQTKWLTI---------------------------EDDSSSGDEDTNDN 93

  Fly   126 MELIENEEDVFKMLEHVDKEAEEVEK--EAKVEEDDGGNVSVKMFDDDSSIESGNDNDHDLDFEP 188
            .|| |:|:..|..... .||.|.||:  :..:||                             ||
  Fly    94 SEL-ESEKCAFSDFGK-KKEGELVEETFQVLIEE-----------------------------EP 127

  Fly   189 NSSDDDIPLAQRMRGPATGSGPQQDRFSNLDKPKPRPRGRPKKIKPPPPEEEELSDSSSESDDSE 253
                                   .|:..|.|                           :::...|
  Fly   128 -----------------------MDKTLNRD---------------------------AKAQLRE 142

  Fly   254 DGTSRGDKPKRKRIPIEERHLHRIIDCHICHQKFKKAIRYEEHMKYHNDLLPFQCKVETCKKGFT 318
            ||......|.:|.|.:..:...:|..|.:|.........::.||:.|....||.||         
  Fly   143 DGIDEKCVPSQKIIKVSTKLDDQIYICELCGTHATSKPTFQRHMRKHRGERPFGCK--------- 198

  Fly   319 TANGLRIHIDHAHTELSEVHACIAEGCGKTFPRVRLLTFHMKKVHGITKAAAPLRDFPCTECDTV 383
                                                                        :||..
  Fly   199 ------------------------------------------------------------DCDAR 203

  Fly   384 FRCPTALKKHMYKHTGEELPYPCNICGKRFVINSALRDHLMRHAGIKNHVCPYCGVGKTTRQEWN 448
            |.....|:.|...||||: |:.|..|.||:|.......|...|...:.:||..||...||.....
  Fly   204 FLSAGELRAHHRVHTGEQ-PFACRFCEKRYVSYMGRLIHERTHTNDRPYVCEECGKKFTTAYVLK 267

  Fly   449 AHILTHTKEKKFKCRQCDHASHNKQALSNHVK-VVH----EKRK 487
            .|::.||.|:.|:|..||.:...|..|..|.: ::|    :|:|
  Fly   268 NHMVIHTGERNFRCDICDRSFQRKAHLVTHTRSMMHLQNVKKQK 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
D19ANP_477304.1 zf-AD 12..83 CDD:214871 21/83 (25%)
C2H2 Zn finger 343..362 CDD:275368 0/18 (0%)
C2H2 Zn finger 377..397 CDD:275368 5/19 (26%)
zf-H2C2_2 389..414 CDD:290200 11/24 (46%)
C2H2 Zn finger 406..426 CDD:275368 6/19 (32%)
C2H2 Zn finger 434..454 CDD:275368 6/19 (32%)
C2H2 Zn finger 462..483 CDD:275368 6/21 (29%)
C2H2 Zn finger 491..511 CDD:275368
C2H2 Zn finger 519..539 CDD:275368
C2H2 Zn finger 652..673 CDD:275368
C2H2 Zn finger 681..701 CDD:275368
zf-H2C2_2 694..718 CDD:290200
C2H2 Zn finger 709..729 CDD:275368
tolA_full 724..>814 CDD:274303
ouibNP_649822.2 zf-AD 5..78 CDD:214871 21/83 (25%)
COG5048 <158..300 CDD:227381 44/211 (21%)
C2H2 Zn finger 169..189 CDD:275368 4/19 (21%)
C2H2 Zn finger 197..217 CDD:275368 7/88 (8%)
zf-H2C2_2 209..234 CDD:290200 11/25 (44%)
C2H2 Zn finger 225..245 CDD:275368 6/19 (32%)
zf-H2C2_2 241..262 CDD:290200 6/20 (30%)
C2H2 Zn finger 253..273 CDD:275368 6/19 (32%)
zf-H2C2_2 266..288 CDD:290200 8/21 (38%)
C2H2 Zn finger 281..299 CDD:275368 6/17 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24388
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.