DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment D19A and nom

DIOPT Version :9

Sequence 1:NP_477304.1 Gene:D19A / 38718 FlyBaseID:FBgn0022935 Length:845 Species:Drosophila melanogaster
Sequence 2:NP_001262384.1 Gene:nom / 41038 FlyBaseID:FBgn0037617 Length:370 Species:Drosophila melanogaster


Alignment Length:533 Identity:105/533 - (19%)
Similarity:160/533 - (30%) Gaps:227/533 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 SLCRICLNHLQNDAAYDLYLVPG---LSKKLCFCTSLSVEQNDGFPKNLCTLCYTKLNELHDFQK 72
            ::||:|........|.:|: .||   :.:::...|.:.::|....|..:|..|.|.|.....|::
  Fly     4 NVCRVCGRSRLCPKAVELF-KPGRQDILRRIQLITGILLQQIPNAPDMVCFCCQTDLQSAMIFRR 67

  Fly    73 QCVDSVQKFQDLVASNVFACQSSFDVFDPNVAVQDYPAEEEDHVNYDPLLNHKMELIENEEDVFK 137
            ||:...:|:..|:.|:.........| :||                ||  :.|.:..:......:
  Fly    68 QCILQQKKWVPLLQSDKVGASEEKKV-EPN----------------DP--STKKKTTKRRRGRPR 113

  Fly   138 M-LEHVDKEAEEVEKEAKVEEDDGGNVSVKMFDDDSSIESGNDNDHDLDFEPNSSDDDIPLAQRM 201
            | ||.||..... |.:|...|..||:      :.|..:|..|        ||:::|.|:.|    
  Fly   114 MPLEIVDIVVTN-ESKASAGESVGGD------EFDQPVEISN--------EPDATDSDVNL---- 159

  Fly   202 RGPATGSGPQQDRFSNLDKPKPRPRGRPKKIKPPPPEEEELSDSSSESDDSEDGTSRGDKPKRKR 266
                                                ||.:|.|        |||           
  Fly   160 ------------------------------------EEIDLPD--------EDG----------- 169

  Fly   267 IPIEERHLHRIIDCHICHQKFKKAIRYEEHMKYHNDLLPFQCKVETCKKGFTTANGLRIHIDHAH 331
              :|..|                            ||                            
  Fly   170 --LESDH----------------------------DL---------------------------- 176

  Fly   332 TELSEVHACIAEGCGKTFPRVRLLTFHMKKVHGITKAAAPLRDFPCTECDTVFRCPTALKKHMYK 396
                              |.|        ::|            .|..|..:....::|.:|.::
  Fly   177 ------------------PNV--------QIH------------KCDTCGIIKNNKSSLVRHQFE 203

  Fly   397 HTGEELPYPCNICGKRFVINSALRDHLMRHAGIKNHVCPYCGVGKTTRQEWNAHILTHTKEKKFK 461
            |.|.. ||||..|.|.|::.|.|:.|.:.|                           ||.|..|.
  Fly   204 HNGIR-PYPCKECPKTFLVASELKAHNLTH---------------------------HTLEPPFA 240

  Fly   462 CRQCDHASHNKQALSNHVKVVHEKRKDFACQYCGKTFGKSHACKVHERSHTGEKCCECKICGKIF 526
            ||.||....:......|.: ||...:.|.|..|||.|.::...|.|...|...:...|.:|.:.|
  Fly   241 CRYCDRRYFSVVGRKKHER-VHTNERPFVCDQCGKAFTRTCILKAHMAVHQVVRKYSCDVCDRSF 304

  Fly   527 LCEKSLTKHLKTH 539
                ||.|||.||
  Fly   305 ----SLKKHLATH 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
D19ANP_477304.1 zf-AD 12..83 CDD:214871 18/73 (25%)
C2H2 Zn finger 343..362 CDD:275368 2/18 (11%)
C2H2 Zn finger 377..397 CDD:275368 4/19 (21%)
zf-H2C2_2 389..414 CDD:290200 10/24 (42%)
C2H2 Zn finger 406..426 CDD:275368 7/19 (37%)
C2H2 Zn finger 434..454 CDD:275368 0/19 (0%)
C2H2 Zn finger 462..483 CDD:275368 5/20 (25%)
C2H2 Zn finger 491..511 CDD:275368 7/19 (37%)
C2H2 Zn finger 519..539 CDD:275368 8/19 (42%)
C2H2 Zn finger 652..673 CDD:275368
C2H2 Zn finger 681..701 CDD:275368
zf-H2C2_2 694..718 CDD:290200
C2H2 Zn finger 709..729 CDD:275368
tolA_full 724..>814 CDD:274303
nomNP_001262384.1 zf-AD 5..76 CDD:214871 17/71 (24%)
C2H2 Zn finger 184..204 CDD:275368 4/19 (21%)
C2H2 Zn finger 212..261 CDD:275368 17/76 (22%)
zf-H2C2_2 255..278 CDD:290200 9/23 (39%)
C2H2 Zn finger 269..289 CDD:275368 7/19 (37%)
zf-H2C2_2 282..305 CDD:290200 6/26 (23%)
C2H2 Zn finger 297..313 CDD:275368 8/19 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24388
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.