DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment D19A and CG11906

DIOPT Version :9

Sequence 1:NP_477304.1 Gene:D19A / 38718 FlyBaseID:FBgn0022935 Length:845 Species:Drosophila melanogaster
Sequence 2:NP_611402.2 Gene:CG11906 / 37209 FlyBaseID:FBgn0034425 Length:634 Species:Drosophila melanogaster


Alignment Length:606 Identity:109/606 - (17%)
Similarity:182/606 - (30%) Gaps:271/606 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 CRICLNHLQNDAAYDLYLVPG---LSKKLCFC--------TSLSVEQND------GFPKNLCTLC 60
            ||:.     |:|:|| ...|.   .|.::.:|        |.:|..|::      .:|   |.||
  Fly   236 CRVL-----NEASYD-EEAPSRAIRSSRIYYCRHCDAEFETLISKRQHERMKHQQRYP---CDLC 291

  Fly    61 YTKLNELHDFQ--------KQ----CVDSVQKFQDLVASNV----------FACQSSFDVFDPNV 103
            ..:|:..::::        ||    .|:..:..|.::.|.|          .||..::|.:|   
  Fly   292 EAQLDTKYEWEMHHTICQAKQEALAIVEQQEAGQTVMTSRVPRACSMRSRSRACSEAWDRYD--- 353

  Fly   104 AVQDYPAEEEDHVNYDPLLNHKMELIENEEDVFKMLEHVDKEAEEVEKEAKVEEDDGGNVSVKMF 168
                                    :.|.|||                                  
  Fly   354 ------------------------MDEEEED---------------------------------- 360

  Fly   169 DDDSSIESGNDNDHDLDFEPNSSDDDIPLAQRMRGPATGSGPQQDRFSNLDKPKPRPRGRPKKIK 233
            ::|..||||.:       |....::|...|:||.  .||     |...|..:             
  Fly   361 EEDEEIESGGE-------ELEEGEEDAMYARRMN--FTG-----DWIVNHSR------------- 398

  Fly   234 PPPPEEEELSDSSSESDDSEDGTSRGDKPKRKRIPIEERHLHRIIDCHICHQKFKKAIRYEEHMK 298
                     |:|:|..:.|   ...||              :.:::.|:...|        |:..
  Fly   399 ---------SNSNSAGNLS---LLYGD--------------YGMVETHMTTDK--------EYDL 429

  Fly   299 YHNDLLPFQCKVETCKKGFTTANGLRIHIDHAHTELSEVHACIAEGCGKTFPRVRLLTFHMKKVH 363
            |..|||..|.::    |.||                     |....||.....:..|..|....|
  Fly   430 YLLDLLKTQVRL----KSFT---------------------CFTPDCGYQTDTLVALMKHDYMEH 469

  Fly   364 GITKAAAPLRDFPCTECDTVFRCPTALKKHMYKHTGEELPYPCNICGKRFVINSALRDHLMRHAG 428
            .      .:..|.|.:|..||.....|..||  |......|.|:.|.:.|.:...|..|...|..
  Fly   470 W------KMSWFYCHKCGDVFTSKVFLDYHM--HLQNRGLYICHKCREEFELQHQLDRHFQLHRK 526

  Fly   429 IKNHVCPYCGVGKTTRQEW--NAHILTHTKEKKFKCRQCDHASHNKQALS--NHVKVVHEKRKDF 489
            ..|:.|.:|      |.|:  .|.:|.|       |::..|:.:::..:|  ..:.:|:      
  Fly   527 GINYHCNFC------RLEFLSEAKLLAH-------CKKLGHSPNDEPLISIDRSLSIVN------ 572

  Fly   490 ACQYCGKTFGKSHACKVHERSHTGEKCCECKICGKIFLCEKSLTKHLKTHEKRD--LPPAEPLRQ 552
                          |.|...|                    ..::.:|::|:|:  :|       
  Fly   573 --------------CHVPRSS--------------------DYSRIVKSYEEREFYIP------- 596

  Fly   553 QLNIPMPGQMSVPMPGQMPMQ 573
              .||||....:.:|...|.:
  Fly   597 --RIPMPSTQPMHLPQHKPFR 615

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
D19ANP_477304.1 zf-AD 12..83 CDD:214871 20/98 (20%)
C2H2 Zn finger 343..362 CDD:275368 4/18 (22%)
C2H2 Zn finger 377..397 CDD:275368 7/19 (37%)
zf-H2C2_2 389..414 CDD:290200 7/24 (29%)
C2H2 Zn finger 406..426 CDD:275368 5/19 (26%)
C2H2 Zn finger 434..454 CDD:275368 6/21 (29%)
C2H2 Zn finger 462..483 CDD:275368 3/22 (14%)
C2H2 Zn finger 491..511 CDD:275368 2/19 (11%)
C2H2 Zn finger 519..539 CDD:275368 1/19 (5%)
C2H2 Zn finger 652..673 CDD:275368
C2H2 Zn finger 681..701 CDD:275368
zf-H2C2_2 694..718 CDD:290200
C2H2 Zn finger 709..729 CDD:275368
tolA_full 724..>814 CDD:274303
CG11906NP_611402.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24388
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.