DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment D19A and CG17328

DIOPT Version :9

Sequence 1:NP_477304.1 Gene:D19A / 38718 FlyBaseID:FBgn0022935 Length:845 Species:Drosophila melanogaster
Sequence 2:NP_609786.2 Gene:CG17328 / 34962 FlyBaseID:FBgn0028895 Length:413 Species:Drosophila melanogaster


Alignment Length:654 Identity:128/654 - (19%)
Similarity:191/654 - (29%) Gaps:306/654 - (46%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YSIHSLCRICLNHLQ---NDAAYDLYLVPGLSKKLCFCTSLSVEQNDGFPKNLCTLCYTKLNELH 68
            |:||.:||:||..|.   :..:.|..::|  |..|..|..:.|.:.||.|..:|..|..:|....
  Fly     3 YNIHKICRVCLEELHPVTSIYSTDFAMMP--SVMLMQCAKIRVFKTDGLPSVICNNCIYRLGVAF 65

  Fly    69 DFQKQCVDSVQKFQDLVASNVFACQSSFDVFDPNVAVQDYPAEEEDHVNYDPLLNHKMELIEN-E 132
            .|:::|.:|                                         |..|...:.::|: .
  Fly    66 HFKQECENS-----------------------------------------DLRLRQYLGILESWR 89

  Fly   133 EDVFKMLEHVDKEAEEVEKEAKVEEDDGGNVSVKMFDDDSSIESGNDNDHDLDFEPNSSDDDIPL 197
            :|.....:.|:|                                                   ||
  Fly    90 QDAATNTDFVEK---------------------------------------------------PL 103

  Fly   198 AQRMRGPATGSGPQQDRFSNLDKP------KPRPRGRPKKIKPPPPEEEELSDSSSESDDSEDGT 256
            .           ||:|  |:.::|      |.|.|.:.|     ||||.:               
  Fly   104 L-----------PQRD--SDEEEPVDAKVSKRRSRYQRK-----PPEEHK--------------- 135

  Fly   257 SRGDKPKRKRIPIEERHLHRIIDCHICHQKFKKAIRYEEHMKYHNDLLPFQCKVETCKKGFTTAN 321
            .||.||..| :|      |   .|:.||:.||...:..:|::.|....|:||..  |.:.|....
  Fly   136 KRGPKPVPK-MP------H---TCYECHKSFKCIAQLTQHIRTHTGEKPYQCSF--CIQRFAQKY 188

  Fly   322 GLRIHIDHAHTELSEVHACIAEGCGKTFPRVRLLTFHMKKVHGITKAAAPLRDFPCTECDTVFRC 386
            .|::|                   .:|                                      
  Fly   189 NLKVH-------------------ERT-------------------------------------- 196

  Fly   387 PTALKKHMYKHTGEELPYPCNICGKRFVINSALRDHLMRHAGIKNHVCPYCGVGKTTRQEWNAHI 451
                      |||:: |:.|.||.|:|......:.|...|.|:::.||..|..|..|..:.:.|:
  Fly   197 ----------HTGDK-PFQCEICSKQFSALGNFQAHQKIHLGVRDQVCSLCQKGFYTAGDLSKHM 250

  Fly   452 LTHTKEKKFKCRQCDHASHNKQALSNHVKVVHEKRKDFACQYCGKTFG-----KSHACKVH--ER 509
            :|||                  .:.||    |       |..|||.|.     ::|..|:|  |.
  Fly   251 ITHT------------------GIKNH----H-------CDVCGKAFSRRRDMRTHKLKLHPLES 286

  Fly   510 S-------------------------HTGEKCCECKICGKIFLCEKSLTKHLKTHEKRD------ 543
            |                         |...||.:   |.|.|....||:.|.:||...:      
  Fly   287 STNHDIVDDDDDEAIDTDPVGLDTLDHAHFKCPD---CDKAFDTADSLSLHFRTHAANNNLLNLP 348

  Fly   544 LPPAEPLRQQLNIPMPGQMSVPMPG-QMPMQMQTDGLVPMDPNQMPSEDMLKACGGGTAAVPPKP 607
            ||||.|:....:......:..|.|. ||.|......|.|..|                  .||.|
  Fly   349 LPPAPPMSHHYHHDALHHLGPPNPATQMGMAAMAHMLAPPPP------------------PPPTP 395

  Fly   608 KNSR 611
            ...|
  Fly   396 SEGR 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
D19ANP_477304.1 zf-AD 12..83 CDD:214871 20/73 (27%)
C2H2 Zn finger 343..362 CDD:275368 1/18 (6%)
C2H2 Zn finger 377..397 CDD:275368 0/19 (0%)
zf-H2C2_2 389..414 CDD:290200 8/24 (33%)
C2H2 Zn finger 406..426 CDD:275368 6/19 (32%)
C2H2 Zn finger 434..454 CDD:275368 5/19 (26%)
C2H2 Zn finger 462..483 CDD:275368 2/20 (10%)
C2H2 Zn finger 491..511 CDD:275368 10/51 (20%)
C2H2 Zn finger 519..539 CDD:275368 6/19 (32%)
C2H2 Zn finger 652..673 CDD:275368
C2H2 Zn finger 681..701 CDD:275368
zf-H2C2_2 694..718 CDD:290200
C2H2 Zn finger 709..729 CDD:275368
tolA_full 724..>814 CDD:274303
CG17328NP_609786.2 zf-AD 8..80 CDD:214871 22/114 (19%)
COG5048 146..>211 CDD:227381 24/143 (17%)
C2H2 Zn finger 149..169 CDD:275368 6/19 (32%)
C2H2 Zn finger 177..197 CDD:275368 6/88 (7%)
zf-H2C2_2 189..213 CDD:404364 11/91 (12%)
C2H2 Zn finger 205..225 CDD:275368 6/19 (32%)
C2H2 Zn finger 233..253 CDD:275368 5/19 (26%)
zf-H2C2_2 245..270 CDD:404364 12/53 (23%)
C2H2 Zn finger 261..282 CDD:275368 7/20 (35%)
C2H2 Zn finger 318..338 CDD:275368 7/22 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449810
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.