DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment D19A and CG2116

DIOPT Version :9

Sequence 1:NP_477304.1 Gene:D19A / 38718 FlyBaseID:FBgn0022935 Length:845 Species:Drosophila melanogaster
Sequence 2:NP_572444.2 Gene:CG2116 / 31735 FlyBaseID:FBgn0030003 Length:598 Species:Drosophila melanogaster


Alignment Length:541 Identity:122/541 - (22%)
Similarity:195/541 - (36%) Gaps:140/541 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 QDYPAEEEDHVNYDPLLNHKM----------ELIENEEDVFKMLEHVDKEAE--------EVEKE 152
            :|.....|:.|..:.|::.::          :|.::|:    |.:.|.:|.:        |||.|
  Fly    54 EDIIIVNENGVEKEMLMSKELRDFIVGSRVKDLTDDEQ----MPQFVVRELDMSEVGDLVEVEPE 114

  Fly   153 AKVEED--DGGNVSVKMFDDDSSIESGNDN---DHDLDFEPNSSDDDIPLAQRMRGPATGSGPQQ 212
            .:.|.|  |.|:     ::.:.|.....||   :.|||..|.||....|...|...|..      
  Fly   115 MEQEADYGDYGD-----YEHEPSYGHPRDNERVEEDLDMYPPSSPSLPPSPPRPPSPVV------ 168

  Fly   213 DRFSNLDKPKPRPRGRPKKIKPPPPEEEELSDSSSESDDSEDGTSRGDKPKRKRIPIEERHLHRI 277
                   :|..:.|...::|       ...|..|.:::|.:||:.:..||..|.:          
  Fly   169 -------QPASKARNSARQI-------ALRSFVSQKNNDDDDGSVKEVKPSEKML---------- 209

  Fly   278 IDCHICHQKFKKAIRYEEHMKYHNDLLPFQCKVETCKKGFTTANGLRIHIDHAHTELSEVHACIA 342
                   ::||...||    ...:||:                 ...:..|...|.|.| .:.|:
  Fly   210 -------EEFKGPRRY----MLFDDLI-----------------ATIVDFDEDSTPLVE-FSMIS 245

  Fly   343 E--------GCGKTFPRVRLLTFHMKKV--HGITKAAAPLRDFPCTECDTVFRCPTALKKHMYKH 397
            :        .|| ..|.|    .|..|:  |..|........:.|..|...:|....|..|..:|
  Fly   246 DIMDEKLPVECG-ICPDV----MHKSKLSKHHKTHLVPGTNRYACIYCTETYRDCKYLAGHARRH 305

  Fly   398 TGEELPYPCNICGKRFVINSALRDHLMRHAGIKNHVCPYCGVGKTTRQEWNAHI-----LTHTKE 457
            .|.. ||.|.:|...|.....||.|..|....|.|:|..|  |||..|  |..:     .||.|:
  Fly   306 MGIR-PYVCELCTLYFSTKQDLRVHNQRRHLEKEHICEVC--GKTFAQ--NTQLKRHREATHEKK 365

  Fly   458 KKFKCRQCDHASHNKQALSNHVKVVH-EKRKDFACQYCGKTFGKSHACKVHERS-HTGEKCCECK 520
            ::|:|..|..|.:...:|..|::.|| .||:...|.:||.....:|....|.:. |..:....|.
  Fly   366 RRFQCEYCQKAYYKNFSLQEHIRNVHMGKRRMLKCPFCGMQCRDAHKMARHRKEMHLSQGTYVCH 430

  Fly   521 ICGKIFL-------------CEKSLTKHLKTHEKRDLPPAEPLRQQLNIPMPGQMSVPMPGQMPM 572
            :|.:.|.             |..:..:.:.....|:...:|.:..:   .|.|| .....|..|:
  Fly   431 LCQEEFTDISYFDAHKRSIQCRSNTRRFVNADGNREGSDSESISGR---NMNGQ-DDDYDGMGPL 491

  Fly   573 QM---QTDGLVPMDPNQMPSE 590
            |.   :.|||: ::.|| |.|
  Fly   492 QEEYDEDDGLL-VEDNQ-PEE 510

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
D19ANP_477304.1 zf-AD 12..83 CDD:214871
C2H2 Zn finger 343..362 CDD:275368 5/26 (19%)
C2H2 Zn finger 377..397 CDD:275368 5/19 (26%)
zf-H2C2_2 389..414 CDD:290200 8/24 (33%)
C2H2 Zn finger 406..426 CDD:275368 6/19 (32%)
C2H2 Zn finger 434..454 CDD:275368 7/24 (29%)
C2H2 Zn finger 462..483 CDD:275368 5/20 (25%)
C2H2 Zn finger 491..511 CDD:275368 5/20 (25%)
C2H2 Zn finger 519..539 CDD:275368 4/32 (13%)
C2H2 Zn finger 652..673 CDD:275368
C2H2 Zn finger 681..701 CDD:275368
zf-H2C2_2 694..718 CDD:290200
C2H2 Zn finger 709..729 CDD:275368
tolA_full 724..>814 CDD:274303
CG2116NP_572444.2 C2H2 Zn finger 256..275 CDD:275368 7/23 (30%)
C2H2 Zn finger 285..305 CDD:275368 5/19 (26%)
PHA00733 <308..357 CDD:177301 18/53 (34%)
C2H2 Zn finger 313..334 CDD:275368 7/20 (35%)
C2H2 Zn finger 341..362 CDD:275368 7/24 (29%)
C2H2 Zn finger 370..388 CDD:275368 5/17 (29%)
C2H2 Zn finger 400..418 CDD:275370 5/17 (29%)
C2H2 Zn finger 429..447 CDD:275368 3/17 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449769
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.