DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment D19A and CG11398

DIOPT Version :9

Sequence 1:NP_477304.1 Gene:D19A / 38718 FlyBaseID:FBgn0022935 Length:845 Species:Drosophila melanogaster
Sequence 2:NP_001259122.2 Gene:CG11398 / 31070 FlyBaseID:FBgn0040366 Length:329 Species:Drosophila melanogaster


Alignment Length:174 Identity:49/174 - (28%)
Similarity:72/174 - (41%) Gaps:9/174 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   375 FPCTECDTVFRCPTALKKHMYKHT---GEELP---YPCNICGKRFVINSALRDHLMRHAGIKNHV 433
            |.|..|..:|.....|..|...|.   |::.|   :.|:.||:.|..::||.||:..|..::|:.
  Fly    50 FVCRRCPALFLTREELAAHRPTHRYQGGQQTPASEHACDACGRVFQKHNALVDHMNAHNDVRNYP 114

  Fly   434 CPYCGVGKTTRQEWNAHIL-THTKEKKFKCRQ--CDHASHNKQALSNHVKVVHEKRKDFACQYCG 495
            ||.|......|.....|:. .|.|.....|.:  |......::....|||.||:..::..|..|.
  Fly   115 CPECPARFVQRSNRECHLKNVHRKVYLHSCPEPGCKKRFQQRRECDQHVKTVHQNERNLVCDTCS 179

  Fly   496 KTFGKSHACKVHERSHTGEKCCECKICGKIFLCEKSLTKHLKTH 539
            ..|......:.|..||...|...|.||||:|...::...||..|
  Fly   180 ARFSHPVNYRKHLASHGSAKSYGCPICGKLFGRPENRDVHLFVH 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
D19ANP_477304.1 zf-AD 12..83 CDD:214871
C2H2 Zn finger 343..362 CDD:275368
C2H2 Zn finger 377..397 CDD:275368 5/19 (26%)
zf-H2C2_2 389..414 CDD:290200 8/30 (27%)
C2H2 Zn finger 406..426 CDD:275368 8/19 (42%)
C2H2 Zn finger 434..454 CDD:275368 5/20 (25%)
C2H2 Zn finger 462..483 CDD:275368 5/22 (23%)
C2H2 Zn finger 491..511 CDD:275368 4/19 (21%)
C2H2 Zn finger 519..539 CDD:275368 8/19 (42%)
C2H2 Zn finger 652..673 CDD:275368
C2H2 Zn finger 681..701 CDD:275368
zf-H2C2_2 694..718 CDD:290200
C2H2 Zn finger 709..729 CDD:275368
tolA_full 724..>814 CDD:274303
CG11398NP_001259122.2 C2H2 Zn finger 52..72 CDD:275368 5/19 (26%)
C2H2 Zn finger 87..107 CDD:275368 8/19 (42%)
C2H2 Zn finger 115..136 CDD:275368 5/20 (25%)
C2H2 Zn finger 144..165 CDD:275368 4/20 (20%)
C2H2 Zn finger 175..195 CDD:275368 4/19 (21%)
C2H2 Zn finger 203..223 CDD:275368 8/19 (42%)
C2H2 Zn finger 231..247 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449836
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.