DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment D19A and Plag1

DIOPT Version :9

Sequence 1:NP_477304.1 Gene:D19A / 38718 FlyBaseID:FBgn0022935 Length:845 Species:Drosophila melanogaster
Sequence 2:NP_001008317.1 Gene:Plag1 / 297804 RGDID:1305286 Length:499 Species:Rattus norvegicus


Alignment Length:443 Identity:111/443 - (25%)
Similarity:164/443 - (37%) Gaps:88/443 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   247 SESDDSEDGTS----RGDKPKRKRIPIEERHLHRIIDCHICHQKFKKAIRYEEHMKYHNDLLPFQ 307
            ||..|::...|    ||:...||..|           |.:|.:.|....:.:.|...|....|::
  Rat    10 SEVRDTQKAPSGKRKRGESKPRKNFP-----------CQLCDKAFNSVEKLKVHSFSHTGERPYK 63

  Fly   308 CKVETCKKGFTTANGLRIHIDHAHTELSEVHACIAEGCGKTFPRVRLLTFHMKKVHGITKAAAPL 372
            |..:.|.|.|.:...|:.|:  |.....:.|.|  ..|.|.|.|...|..|: ..|...|     
  Rat    64 CTHQDCTKAFVSKYKLQRHM--ATHSPEKTHKC--NYCEKMFHRKDHLKNHL-HTHDPNK----- 118

  Fly   373 RDFPCTECDTVFRCPTALKKHMYKHTGEELPYPCNICGKRFVINSALRDHLMRHAGIKNHVCPYC 437
            ..|.|.||...:......|:|:..|........|.:|.:.|.....|.:||..|||..:.     
  Rat   119 ETFKCEECGKSYNTKLGFKRHLALHAATSGDLTCKVCLQTFESTGVLLEHLKSHAGKSSG----- 178

  Fly   438 GVGKTTRQEWNAHILTHTKEKKFKCRQCDHASHNKQALSNHVKVVHEKRKDFACQYCGKTFG-KS 501
            ||                ||||.:|..|:...:.::.:..|: |||..||||.||||.:.|| |.
  Rat   179 GV----------------KEKKHQCEHCERRFYTRKDVRRHM-VVHTGRKDFLCQYCAQRFGRKD 226

  Fly   502 HACKVHERSHTGEKCCECKICGKI----------FLCEKSLTKHLKTHEKRDLPPAEPLRQ---- 552
            |..:..::||..|..       |:          |.|..|:....:......||.:|.|.:    
  Rat   227 HLTRHMKKSHNQELL-------KVKTEPVDFLDPFTCNMSVPIKDELLPVMSLPSSELLSKPFTN 284

  Fly   553 --QLNI---PMPGQMSVPMPGQMPMQMQTDGLVPMDPNQM-PSEDMLKACGGGTA----AVPPKP 607
              |||:   |.....|.....||...:......|:|.:.: ||..:...|...:.    ::|.|.
  Rat   285 TLQLNLYNTPFQSMQSSGSTHQMITTLPLGMTCPIDMDTVHPSHHLAFKCPFSSTSYAISIPEKE 349

  Fly   608 KNSRRVQRVDISQLAGTAVNPIPSVSVPSWSPQVNFTK--KEGQHICPGCGRG 658
            :..:......:.:|.|.|    ||.|..|   |.:.:|  .|.|...|..|.|
  Rat   350 QPLKGEIESYLMELQGGA----PSSSQDS---QASSSKLGLEPQSGSPDDGAG 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
D19ANP_477304.1 zf-AD 12..83 CDD:214871
C2H2 Zn finger 343..362 CDD:275368 6/18 (33%)
C2H2 Zn finger 377..397 CDD:275368 5/19 (26%)
zf-H2C2_2 389..414 CDD:290200 5/24 (21%)
C2H2 Zn finger 406..426 CDD:275368 6/19 (32%)
C2H2 Zn finger 434..454 CDD:275368 2/19 (11%)
C2H2 Zn finger 462..483 CDD:275368 4/20 (20%)
C2H2 Zn finger 491..511 CDD:275368 8/20 (40%)
C2H2 Zn finger 519..539 CDD:275368 4/29 (14%)
C2H2 Zn finger 652..673 CDD:275368 3/7 (43%)
C2H2 Zn finger 681..701 CDD:275368
zf-H2C2_2 694..718 CDD:290200
C2H2 Zn finger 709..729 CDD:275368
tolA_full 724..>814 CDD:274303
Plag1NP_001008317.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..33 7/22 (32%)
Interaction with KPNA2. /evidence=ECO:0000250 2..84 21/86 (24%)
Nuclear localization signal. /evidence=ECO:0000250 22..25 0/2 (0%)
C2H2 Zn finger 36..56 CDD:275368 4/19 (21%)
Decreased nuclear import with localization in the nucleus but also in the cytoplasm. /evidence=ECO:0000250 41..242 64/239 (27%)
SFP1 <58..139 CDD:227516 23/90 (26%)
C2H2 Zn finger 64..86 CDD:275368 7/23 (30%)
zf-H2C2_2 79..103 CDD:404364 8/27 (30%)
C2H2 Zn finger 94..114 CDD:275368 7/22 (32%)
C2H2 Zn finger 123..143 CDD:275368 5/19 (26%)
C2H2 Zn finger 152..172 CDD:275368 6/19 (32%)
C2H2 Zn finger 187..207 CDD:275368 4/20 (20%)
C2H2 Zn finger 215..233 CDD:275368 8/17 (47%)
Activates transcription, Inhibition of nuclear import due to lack of NLS and KPNA2 interaction. /evidence=ECO:0000250 243..499 35/160 (22%)
Repression domain, contains 3 sumoylation motifs and massively decrease transcription activity. /evidence=ECO:0000250 243..383 30/146 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 364..400 13/39 (33%)
Massively activates transcription. /evidence=ECO:0000250 384..499 5/12 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24388
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.