DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment D19A and ZK546.5

DIOPT Version :9

Sequence 1:NP_477304.1 Gene:D19A / 38718 FlyBaseID:FBgn0022935 Length:845 Species:Drosophila melanogaster
Sequence 2:NP_001364799.1 Gene:ZK546.5 / 173850 WormBaseID:WBGene00022762 Length:581 Species:Caenorhabditis elegans


Alignment Length:595 Identity:121/595 - (20%)
Similarity:191/595 - (32%) Gaps:227/595 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   227 GRPKKIKPPPPEEEELSDSSSESDDSEDGTSRGDKPKRKRIPIEERHLHRIIDCHICHQKFKKAI 291
            |.|:  |||....:.::...:..|..:|   .|:|.||:...::...| .:.:.|..:.|.||. 
 Worm     7 GGPR--KPPRIIRKNVALKHTRKDVRDD---EGEKVKREGYEVQSGVL-TVNENHPSNFKPKKL- 64

  Fly   292 RYEEHMKYHNDLLPFQCKVETC-KKGFTTANGLRIHIDHAHTE-LSEVHACIAEGCG----KTFP 350
                 ....||:..:.|:.  | :|.|.||:||..|....|.: |.::...|...||    :.|.
 Worm    65 -----PGIANDVESYPCRF--CEEKIFLTASGLEKHGRECHLQNLDDIMLDINTICGEWKKREFE 122

  Fly   351 RVR---LLTF----HMKKVHGITKAAAPLRDFP---------CTECDTVFRC--PTALKKHMYKH 397
            |:|   .||.    |..:.|.:.||.. ..:.|         ||.|:.:...  |||::.|...|
 Worm   123 RLRSRDRLTMDKMRHEARAHQLVKAVL-AGNQPTVGGEQYEACTICNMLVNIAHPTAMESHQRAH 186

  Fly   398 TGEELPYPCNICGKRFVINSALRDHLMRHAG---IKNHVCPYCGVGKTTRQEWNAHILT-HTKEK 458
                         |:   |..||..|:...|   ::|..|..|.:......:..||:.: ||:.|
 Worm   187 -------------KK---NDELRLQLIDRLGAHEVQNLTCELCSLVFPDDGKLRAHVTSHHTRRK 235

  Fly   459 KFKCRQCDHASHNKQALSNHVKVVHEKRKDFACQYCGKTFGKSHACKVHERSHTGEKCCECKICG 523
            |:.|:.|.|.||:...|:.|...||.                                       
 Worm   236 KYICKFCGHISHSMSELNLHKNDVHN--------------------------------------- 261

  Fly   524 KIFLCEKSLTKHLKT---------HEKRDLPPAEPLRQQLNIPMPGQMSVPMP--GQMPMQMQTD 577
              :....::.::||:         .:||       ||::.|..|..:||:.:|  |::       
 Worm   262 --YTAWANVPEYLKSRRTFYQYDEEQKR-------LRRRTNFEMADEMSIRLPILGEI------- 310

  Fly   578 GLVPMDPNQMPSEDMLKACGGGTAAVPPKPKNSRRVQRVDISQLAGTAVNPIPSVSVPSWSPQVN 642
                              ..|.||                                         
 Worm   311 ------------------SDGDTA----------------------------------------- 316

  Fly   643 FTKKEGQHICPGCGRGFNNIGNMKLHYKIIHEKVKDFACRFCPKRFSKAQILRHHEWIHTGEKP- 706
                 |:..||.||...|....:..|.:.:|.| ..|:|                 .:.||..| 
 Worm   317 -----GRVTCPECGLKLNRPRLLFKHMERVHMK-SSFSC-----------------MVETGGLPT 358

  Fly   707 FECKI---------CGKHFRQETALKKHIKTHEKPNRRHVPERSA--PTQI--TFRKLEPD---- 754
            ||.::         |...|.......:|.:.|.......|...|:  |..|  |.:.:.||    
 Worm   359 FELEVSNGEIFWTCCDSKFDNRPEFIEHRRLHIPTQHEEVVVESSEDPNDIPSTSQAMIPDEDAN 423

  Fly   755 --AEPRNFDQ 762
              ||..||.|
 Worm   424 EAAEQHNFPQ 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
D19ANP_477304.1 zf-AD 12..83 CDD:214871
C2H2 Zn finger 343..362 CDD:275368 8/29 (28%)
C2H2 Zn finger 377..397 CDD:275368 7/21 (33%)
zf-H2C2_2 389..414 CDD:290200 4/24 (17%)
C2H2 Zn finger 406..426 CDD:275368 5/19 (26%)
C2H2 Zn finger 434..454 CDD:275368 4/20 (20%)
C2H2 Zn finger 462..483 CDD:275368 7/20 (35%)
C2H2 Zn finger 491..511 CDD:275368 0/19 (0%)
C2H2 Zn finger 519..539 CDD:275368 2/28 (7%)
C2H2 Zn finger 652..673 CDD:275368 6/20 (30%)
C2H2 Zn finger 681..701 CDD:275368 1/19 (5%)
zf-H2C2_2 694..718 CDD:290200 7/33 (21%)
C2H2 Zn finger 709..729 CDD:275368 3/28 (11%)
tolA_full 724..>814 CDD:274303 14/49 (29%)
ZK546.5NP_001364799.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S12366
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.