DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment D19A and hinf-1

DIOPT Version :9

Sequence 1:NP_477304.1 Gene:D19A / 38718 FlyBaseID:FBgn0022935 Length:845 Species:Drosophila melanogaster
Sequence 2:NP_493579.2 Gene:hinf-1 / 173348 WormBaseID:WBGene00009553 Length:541 Species:Caenorhabditis elegans


Alignment Length:481 Identity:100/481 - (20%)
Similarity:156/481 - (32%) Gaps:167/481 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   184 LDFEPNSSDDDIPLAQRMRGPATGSG--------PQQDRFSNLDKPKPRPRGRPKKIKPPPPEEE 240
            :|.:.:.|.|.:   ...|.||..|.        |:..|.|:.|.                 |..
 Worm    67 IDSQDSDSQDSV---DSFRTPAPISSATRFSTHTPRASRASSNDS-----------------ESG 111

  Fly   241 ELSD--------------------------------SSSESDDS------------EDGTSRGDK 261
            |||:                                |||.|.|.            |:|...|:.
 Worm   112 ELSEEVMNHWLPMTWCERSSDDPQVFTFVCLWGQCVSSSSSKDEFVDHLFGHVSVIEEGVQNGNH 176

  Fly   262 PKRKRIPIE--ERH------LHRIIDCHI----CHQKFKKAIRYEE--------------HMKYH 300
            ....:..:.  .:|      |||.:..|:    |.||..:|:..:|              ::.|.
 Worm   177 MNTVQCKVRGCNKHLDSIFQLHRHVSMHVFQADCQQKGSEALIEKEDYIGIESCGFEPCTNINYE 241

  Fly   301 NDLLPFQCKVETCKKGFTTANGLRIHIDHAHTELSEVHACIAEGCGKTFPRVRLLTFHMKKVHGI 365
            ..||  .|:.|.|...|.:...|..|:.|        |   .:|.|......:..:...|||   
 Worm   242 GMLL--NCQWEDCGMPFNSLTELFDHVGH--------H---IDGVGDVDRIQQNFSNGDKKV--- 290

  Fly   366 TKAAAPLRDFPC--TECDTVFRCPTALKKHMYKHTGEEL-------------------------- 402
                    .|||  |.|..|......|::|...|:||::                          
 Worm   291 --------VFPCKWTACTQVADSKANLRRHARHHSGEKVLACPFCARFFSRRDKLYDHCLRRTIL 347

  Fly   403 --------PYPCNICGKRFVINSALRDHLMRHAGIKNHVCPYCGVGKTTRQEWNAHILT-HTKEK 458
                    ||.|.:|.|||....||..|:.||  :.:..||.|.:|...|.|.:.|::| |::..
 Worm   348 MKNPEMEDPYLCKLCQKRFGTEKALCMHVTRH--LVSLTCPLCSLGLGCRAELHRHLMTKHSRRS 410

  Fly   459 K-FKCRQCDHASHNKQALSNHVKVVHEKRKDFACQYCGKTFGKSHACKVHERSHT---GEKCCEC 519
            | |||..|......:..|:.|  .|:.....::|::|.:.|........|.:.|.   ......|
 Worm   411 KDFKCDTCSKLFFTESELNRH--AVYHSDVMYSCKHCPEKFKWKKQLMKHMKEHDENFNPSPYTC 473

  Fly   520 KICGKIFLCEKSLTKHLKTHEKRDLP 545
            .:|.:.:....:|.:||....:..:|
 Worm   474 HLCDRTYTTGFALGRHLTRQHRLQIP 499

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
D19ANP_477304.1 zf-AD 12..83 CDD:214871
C2H2 Zn finger 343..362 CDD:275368 3/18 (17%)
C2H2 Zn finger 377..397 CDD:275368 6/21 (29%)
zf-H2C2_2 389..414 CDD:290200 11/58 (19%)
C2H2 Zn finger 406..426 CDD:275368 8/19 (42%)
C2H2 Zn finger 434..454 CDD:275368 8/20 (40%)
C2H2 Zn finger 462..483 CDD:275368 4/20 (20%)
C2H2 Zn finger 491..511 CDD:275368 4/19 (21%)
C2H2 Zn finger 519..539 CDD:275368 5/19 (26%)
C2H2 Zn finger 652..673 CDD:275368
C2H2 Zn finger 681..701 CDD:275368
zf-H2C2_2 694..718 CDD:290200
C2H2 Zn finger 709..729 CDD:275368
tolA_full 724..>814 CDD:274303
hinf-1NP_493579.2 C2H2 Zn finger 299..316 CDD:275368 4/16 (25%)
C2H2 Zn finger 324..344 CDD:275368 0/19 (0%)
C2H2 Zn finger 359..379 CDD:275368 8/19 (42%)
C2H2 Zn finger 385..406 CDD:275368 8/20 (40%)
C2H2 Zn finger 415..435 CDD:275368 5/21 (24%)
C2H2 Zn finger 442..462 CDD:275368 4/19 (21%)
C2H2 Zn finger 473..494 CDD:275368 5/20 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.