DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment D19A and zgc:174268

DIOPT Version :9

Sequence 1:NP_477304.1 Gene:D19A / 38718 FlyBaseID:FBgn0022935 Length:845 Species:Drosophila melanogaster
Sequence 2:XP_017208296.1 Gene:zgc:174268 / 100001296 ZFINID:ZDB-GENE-080219-18 Length:623 Species:Danio rerio


Alignment Length:483 Identity:142/483 - (29%)
Similarity:200/483 - (41%) Gaps:96/483 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   272 RHLH-------RIIDCHICHQKFKKAIRYEEHMKYHNDLLPFQCKVETCKKGFTTANGLRIHID- 328
            |.:|       ::..|..|.:.|.......:||:.|....|:.|  ..|.|.||.::.|..|:. 
Zfish    47 RKIHMMSHTGKKLSTCTQCGKSFTGPSHLNKHMRIHTGEKPYTC--TQCGKSFTQSSNLNEHMKI 109

  Fly   329 HAHTELSEVHACIAEGCGKTFPRVRLLTFHMKKVHGITKAAAPLRDFPCTECDTVFRCPTALKKH 393
            |:..:|   ..|  ..|||:|.....|..|: ::|...|      .|.||:|...|...::|.:|
Zfish   110 HSGEKL---FTC--TWCGKSFTLSSYLNKHL-RIHTGEK------PFTCTQCGRSFIRFSSLNQH 162

  Fly   394 MYKHTGEELPYPCNICGKRFVINSALRDHLMRHAGIKNHVCPYCGVGKTTRQEWNAHILTHTKEK 458
            |..||||. |:.|..|||.|...|.|..|::.|.|.|.|.|..||.|..|....|.|:|.||.|:
Zfish   163 MVIHTGER-PFTCTQCGKSFTQLSNLNKHMLIHTGEKPHTCTQCGKGFRTSSHLNQHMLIHTGER 226

  Fly   459 KFKCRQCDHASHNKQALSNHVKVVHEKRKDFACQYCGKTFGKSHACKVHERSHTGEKCCECKICG 523
            |.||.||.........|..|:: ||.|.|.::|..||::|.......:|::.|||.:...|..||
Zfish   227 KHKCDQCGKTFRRGPLLKAHLR-VHTKEKPYSCSVCGRSFAAQSNLSLHQKIHTGVREFVCFGCG 290

  Fly   524 KIFLCEKSLTKHLKTH--EK--------RDLPPAEPLRQQLNIPMPGQMSVPMPGQMPMQMQTDG 578
            |.|:....|.:|.:.|  ||        |.....|.|:....|         ..|:.|.      
Zfish   291 KTFMTAGLLKRHQRIHTGEKPYTCSHCDRRFSHLETLKIHERI---------HTGEKPY------ 340

  Fly   579 LVPMDPNQMPSEDMLKACGGGTAAVPPKPKNSRRVQRVDISQLAGTAVNPIPSVSVPSWSPQVNF 643
                         ....||          |....::.:...:...|...|               
Zfish   341 -------------ACSHCG----------KTFSHLETLKAHERIHTGEKP--------------- 367

  Fly   644 TKKEGQHICPGCGRGFNNIGNMKLHYKIIHEKVKDFACRFCPKRFSKAQILRHHEWIHTGEKPFE 708
                  :.|..||:.|..:..:|.| |.||...|.|:|..|.:.|:::.||..|..|||||||::
Zfish   368 ------YRCSHCGKTFRQMQTLKAH-KRIHTGEKPFSCTQCGQSFTRSSILNEHMKIHTGEKPYK 425

  Fly   709 CKICGKHFRQETALKKH--IKTHEKPNR 734
            |..|||.|.|.:.||||  |.|.|||::
Zfish   426 CTQCGKSFGQSSTLKKHTMIHTGEKPHK 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
D19ANP_477304.1 zf-AD 12..83 CDD:214871
C2H2 Zn finger 343..362 CDD:275368 6/18 (33%)
C2H2 Zn finger 377..397 CDD:275368 7/19 (37%)
zf-H2C2_2 389..414 CDD:290200 12/24 (50%)
C2H2 Zn finger 406..426 CDD:275368 8/19 (42%)
C2H2 Zn finger 434..454 CDD:275368 8/19 (42%)
C2H2 Zn finger 462..483 CDD:275368 5/20 (25%)
C2H2 Zn finger 491..511 CDD:275368 5/19 (26%)
C2H2 Zn finger 519..539 CDD:275368 7/19 (37%)
C2H2 Zn finger 652..673 CDD:275368 7/20 (35%)
C2H2 Zn finger 681..701 CDD:275368 6/19 (32%)
zf-H2C2_2 694..718 CDD:290200 14/23 (61%)
C2H2 Zn finger 709..729 CDD:275368 11/21 (52%)
tolA_full 724..>814 CDD:274303 7/13 (54%)
zgc:174268XP_017208296.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.