DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment D19B and TFIIIA

DIOPT Version :9

Sequence 1:NP_477297.1 Gene:D19B / 38717 FlyBaseID:FBgn0022699 Length:774 Species:Drosophila melanogaster
Sequence 2:NP_001322779.1 Gene:TFIIIA / 843536 AraportID:AT1G72050 Length:427 Species:Arabidopsis thaliana


Alignment Length:576 Identity:118/576 - (20%)
Similarity:176/576 - (30%) Gaps:210/576 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 SGNDNDLD------ADFQISSDDDIP--LAQ-----RSRRG-ATRGSKAKGKPKSAAKRQEEESE 218
            |..||..|      .|.:.|:..||.  |.|     ||:.. .|:..::..:.:...:|.:|..|
plant     8 SSVDNKRDMAEEAKVDVKTSAKKDIRNYLCQYCGISRSKNYLITKHIQSHHQMELEEERDDEACE 72

  Fly   219 ESEETSSSDDSDGNPKDKPKRKRIPATERDRHRLIDCHICHQKFKKAIRYEEHMKHHNDLLPFQC 283
            ..||:||:.                          .|..|..:|||....::||:.|:....|.|
plant    73 VDEESSSNH--------------------------TCQECGAEFKKPAHLKQHMQSHSLERSFTC 111

  Fly   284 TVESCRKGFTTANGLRVHVEHAHTETSAMHPCTYEGCNKSFARPVLLSFHMKRVHKVDT------ 342
            .|:.|...:...:.|.   .|..|....:..|..|.|...|:....:..|:|:.|..|.      
plant   112 YVDDCAASYRRKDHLN---RHLLTHKGKLFKCPKENCKSEFSVQGNVGRHVKKYHSNDNRDKDNT 173

  Fly   343 ----PQRDFPCT-----------ECEKVFRCPTALKKHMYKHTGEELPFACEICGKRFPINSVLR 392
                ..:|..|.           .|||.........|. ....|:..|..|.             
plant   174 GLGDGDKDNTCKGDDDKEKSGSGGCEKENEGNGGSGKD-NNGNGDSQPAECS------------- 224

  Fly   393 DHLLRHAGIKNHVCPYCGVGKTTR--QEWNKHILTHTKEKKYE--CRQ--CDHASHNKQALANHV 451
                  .|.|..||...|.||..:  .:..||..:|.|....|  |.:  |.....|::.|.:|:
plant   225 ------TGQKQVVCKEIGCGKAFKYPSQLQKHQDSHVKLDSVEAFCSEPGCMKYFTNEECLKSHI 283

  Fly   452 KVVHEKRKDFACQYCGKTFGKSHACKIHERSHTGEKCCECKICGKVFLFEKGLTKHLKTHEKRDL 516
            :..|:.                               ..|:|||...| :|.:.:||:||::...
plant   284 RSCHQH-------------------------------INCEICGSKHL-KKNIKRHLRTHDEDSS 316

  Fly   517 PKTQGTNALMGDGASGSSTIAKPSPHLRGRVERVDIAQLAGTVANPIPSVNLPSWSPQVNFTKKE 581
            |                           |.::                             .:.|
plant   317 P---------------------------GEIK-----------------------------CEVE 325

  Fly   582 GQHICPDCGKGFNHVSNMKLHYKVVHQKVKDFCCRF--CPKRFAKKQYLRHHEYIHTGEKPYECK 644
            |      |...|:..||::.|.|.||..::.|.|.|  |..|||.|.....||  ::|   |...
plant   326 G------CSSTFSKASNLQKHMKAVHDDIRPFVCGFPGCGMRFAYKHVRNKHE--NSG---YHVY 379

  Fly   645 VCGKHFRQEQVLKTHMKVHDKPPRPPGKPKEPAGPKAESSTAV----KRQQPKNFE 696
            .||.....::         |...||.|      |.|.:..||.    ||..|..|:
plant   380 TCGDFVETDE---------DFTSRPRG------GLKRKQVTAEMLVRKRVMPPRFD 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
D19BNP_477297.1 zf-AD 12..83 CDD:214871
C2H2 Zn finger 255..275 CDD:275368 7/19 (37%)
C2H2 Zn finger 283..335 CDD:275368 11/51 (22%)
C2H2 Zn finger 318..338 CDD:275368 5/19 (26%)
COG5048 <347..512 CDD:227381 35/181 (19%)
C2H2 Zn finger 349..369 CDD:275368 5/30 (17%)
C2H2 Zn finger 378..398 CDD:275368 1/19 (5%)
C2H2 Zn finger 406..426 CDD:275368 6/21 (29%)
C2H2 Zn finger 434..455 CDD:275368 5/22 (23%)
C2H2 Zn finger 463..483 CDD:275368 0/19 (0%)
C2H2 Zn finger 491..511 CDD:275368 8/19 (42%)
C2H2 Zn finger 586..607 CDD:275368 6/20 (30%)
C2H2 Zn finger 615..635 CDD:275368 9/21 (43%)
zf-H2C2_2 627..652 CDD:290200 6/24 (25%)
C2H2 Zn finger 643..663 CDD:275368 2/19 (11%)
TFIIIANP_001322779.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.