DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment D19B and plag1

DIOPT Version :9

Sequence 1:NP_477297.1 Gene:D19B / 38717 FlyBaseID:FBgn0022699 Length:774 Species:Drosophila melanogaster
Sequence 2:NP_001034903.1 Gene:plag1 / 561450 ZFINID:ZDB-GENE-060302-2 Length:393 Species:Danio rerio


Alignment Length:364 Identity:104/364 - (28%)
Similarity:151/364 - (41%) Gaps:68/364 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   232 NPKDKPK-------RKRIPATERDRHRLIDCHICHQKFKKAIRYEEHMKHHNDLLPFQCTVESCR 289
            :|||.|.       |||  ..|....:...|.:|.:.|....:.:.|...|....|:.||...|.
Zfish     5 SPKDCPTVADHCRVRKR--REEGKVRKNFSCQLCEKAFNSLEKLKVHSYSHTGERPYHCTHTDCT 67

  Fly   290 KGFTTANGLRVHV-EHAHTETSAMHPCTYEGCNKSFARPVLLSFHMKRVHKVDTPQRDFPCTECE 353
            |.|.:...|..|: .|:..:|   |.|:|  |.|.|.|...|..|:   |..|..:..|.||||:
Zfish    68 KAFVSKYKLLRHMATHSPEKT---HKCSY--CEKMFHRKDHLKNHL---HTHDPNKEAFSCTECD 124

  Fly   354 KVFRCPTALKKHMYKHTGEELPFACEICGKRFPINSVLRDHLLRHAGIKNHVCPYCGVGKTTRQE 418
            |.:......::|...|..:.....|::|.:.:|...:|.:||..||            ||:.   
Zfish   125 KSYNTKLGFRRHQALHAAQRGDLTCQVCLQSYPSTPLLLEHLRGHA------------GKSA--- 174

  Fly   419 WNKHILTHTKEKKYECRQCDHASHNKQALANHVKVVHEKRKDFACQYCGKTFG-KSHACKIHERS 482
                  |.||||:::|.||:...:.::.:..|: |||..||||.||||.:.|| |.|..:..::|
Zfish   175 ------TATKEKRHQCDQCERRFYTRKDVRRHL-VVHTGRKDFLCQYCAQRFGRKDHLTRHVKKS 232

  Fly   483 HTGEKCCECKICGKVFLFEKGLTKHLKTHEKRDLPKTQGTNALMGDGASGSSTIAKPSPHLRGRV 547
            |..|           .|..|  .:.:...|.:.|| |.|...|....|..|.:   |.|.||..:
Zfish   233 HAHE-----------LLRVK--AEPVDLMESQSLP-TSGPLTLRYPLAHASYS---PPPPLRAEL 280

  Fly   548 ERV-------DIAQLAG--TVANPIPSVNLPSWSPQVNF 577
            |..       |..:|:.  ||.....| :|...||..||
Zfish   281 ESYLLELQAEDTPKLSSSTTVTGETTS-SLDFLSPLFNF 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
D19BNP_477297.1 zf-AD 12..83 CDD:214871
C2H2 Zn finger 255..275 CDD:275368 4/19 (21%)
C2H2 Zn finger 283..335 CDD:275368 18/52 (35%)
C2H2 Zn finger 318..338 CDD:275368 6/19 (32%)
COG5048 <347..512 CDD:227381 47/165 (28%)
C2H2 Zn finger 349..369 CDD:275368 6/19 (32%)
C2H2 Zn finger 378..398 CDD:275368 6/19 (32%)
C2H2 Zn finger 406..426 CDD:275368 2/19 (11%)
C2H2 Zn finger 434..455 CDD:275368 5/20 (25%)
C2H2 Zn finger 463..483 CDD:275368 8/20 (40%)
C2H2 Zn finger 491..511 CDD:275368 2/19 (11%)
C2H2 Zn finger 586..607 CDD:275368
C2H2 Zn finger 615..635 CDD:275368
zf-H2C2_2 627..652 CDD:290200
C2H2 Zn finger 643..663 CDD:275368
plag1NP_001034903.1 COG5048 29..>99 CDD:227381 20/74 (27%)
C2H2 Zn finger 33..53 CDD:275368 4/19 (21%)
C2H2 Zn finger 61..83 CDD:275368 7/21 (33%)
zf-H2C2_2 76..100 CDD:290200 10/28 (36%)
C2H2 Zn finger 91..111 CDD:275368 9/24 (38%)
C2H2 Zn finger 120..140 CDD:275368 6/19 (32%)
C2H2 Zn finger 149..169 CDD:275368 6/19 (32%)
C2H2 Zn finger 184..204 CDD:275368 5/20 (25%)
C2H2 Zn finger 212..230 CDD:275368 8/17 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR24388
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.