DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment D19B and topi

DIOPT Version :9

Sequence 1:NP_477297.1 Gene:D19B / 38717 FlyBaseID:FBgn0022699 Length:774 Species:Drosophila melanogaster
Sequence 2:NP_649945.1 Gene:topi / 41199 FlyBaseID:FBgn0037751 Length:814 Species:Drosophila melanogaster


Alignment Length:569 Identity:131/569 - (23%)
Similarity:195/569 - (34%) Gaps:123/569 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   188 LAQRSRRGATRGSKAKGKPKSAAKRQE-----EESEESEETSSSDDSDGNPKDKPKRKRIPATER 247
            |...|.....|.|.....|.:.|...|     |...:::...::.:.:.||   ||::...:...
  Fly   295 LIHDSEHSTMRQSPMTQVPSNRADFNELLLDGEMLIDNDPAFATSNQNTNP---PKKEMFSSLIL 356

  Fly   248 DRHRLIDCHICHQKFKKAIRYEEHMKHHNDLLPFQCTVESCRKGFTTANGLRVH----------- 301
            .  .::.|..|...|........|...|.....|:||  :|.....||....:|           
  Fly   357 G--SVLQCEFCEYIFADIAELLVHSASHVAERRFECT--ACDIQMNTAKEASIHFQTDCIFMREA 417

  Fly   302 VEHAHTETSAMHPCTYEGCNKSFARPVLL------SFH-MKRVHKVDTPQRDFPCTECEKVFR-- 357
            :...:...|....|..  |...||...||      ||| ..|::: :..:...||..|:..|.  
  Fly   418 IRSLNVTLSRYFVCNV--CELKFANTDLLQEHRCTSFHYFPRLNE-NGKKLLLPCDFCDVNFEFA 479

  Fly   358 ---CPTALKKHMYKH----------TGEELPFACEICGKRFPINSVLRDHLLRHAGIKNHVC--P 407
               ...:.:||:.|.          .|....:.|:||||.:..:|.|..||..|.|:|..||  .
  Fly   480 HDFLAHSEEKHLNKKKREKETRNTGAGRIRQYLCDICGKSYTQSSHLWQHLRFHQGVKPFVCQEE 544

  Fly   408 YCGVGKTTRQEWNKHI-LTHTKEKKYECRQCDHASHNKQALANHV----KVVHEKRKDFACQYCG 467
            .|....|.|.:.|.|| ..||.|:.|.|..|     .|:.|...|    :::|...:.:.|:.||
  Fly   545 NCDRKFTIRPDLNDHIRKCHTGERPYLCLVC-----GKRFLTGSVFYQHRLIHRGERRYECEECG 604

  Fly   468 KTFGKSHACKIHERSHTGEKCCECKICGKVFLFEKGLTKHLKT-HEKRD--------LPKTQGTN 523
            |.|.::.|.|.|:|.|||||...|..|.|.|.......||::. |...|        :.|.|...
  Fly   605 KRFYRADALKNHQRIHTGEKPYSCLFCTKTFRQRGDRDKHIRARHSHLDANSRLMMQMQKFQLET 669

  Fly   524 ALMGDGASGSSTIAKPSPHLRGRVERVDIAQLAGTVANPIPSVNLPSWSPQVNFTKKEGQHICPD 588
            |          ...|...|   ..|:.|.....|...:.:||                       
  Fly   670 A----------AAQKAQSH---NPEQQDNDVAGGASTSDVPS----------------------- 698

  Fly   589 CGKGF--NHVSNMKLHYKVVHQKVKDFCCRFCPKRFAKKQYLRHHEYIHTGEKPYECKVCGKH-- 649
             |.||  ...|..::.|.:..::.::..|  .|.......:...| |:..  .|.|....|:|  
  Fly   699 -GSGFMSTEPSVAEMQYSITPEQQEEMVC--VPIDEVNNSFFMSH-YMQA--VPMEEDGSGQHII 757

  Fly   650 -FRQEQVLKTHMKVHD-----KPPRPPGKPKEPAGPKAESSTAVKRQQP 692
             |.|.......|.::|     :|....|.||.||...|.  ..|.:..|
  Fly   758 VFEQPGQNMDMMSIYDQQQVGEPMHESGVPKRPAEENAR--VVVVKNNP 804

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
D19BNP_477297.1 zf-AD 12..83 CDD:214871
C2H2 Zn finger 255..275 CDD:275368 4/19 (21%)
C2H2 Zn finger 283..335 CDD:275368 16/69 (23%)
C2H2 Zn finger 318..338 CDD:275368 9/26 (35%)
COG5048 <347..512 CDD:227381 58/187 (31%)
C2H2 Zn finger 349..369 CDD:275368 5/24 (21%)
C2H2 Zn finger 378..398 CDD:275368 9/19 (47%)
C2H2 Zn finger 406..426 CDD:275368 7/22 (32%)
C2H2 Zn finger 434..455 CDD:275368 5/24 (21%)
C2H2 Zn finger 463..483 CDD:275368 9/19 (47%)
C2H2 Zn finger 491..511 CDD:275368 6/20 (30%)
C2H2 Zn finger 586..607 CDD:275368 5/22 (23%)
C2H2 Zn finger 615..635 CDD:275368 4/19 (21%)
zf-H2C2_2 627..652 CDD:290200 7/27 (26%)
C2H2 Zn finger 643..663 CDD:275368 5/22 (23%)
topiNP_649945.1 C2H2 Zn finger 230..250 CDD:275368
C2H2 Zn finger 277..297 CDD:275368 1/1 (100%)
C2H2 Zn finger 431..453 CDD:275368 7/23 (30%)
COG5048 <450..647 CDD:227381 62/202 (31%)
C2H2 Zn finger 469..490 CDD:275368 3/20 (15%)
zf-C2H2 511..533 CDD:278523 9/21 (43%)
C2H2 Zn finger 513..564 CDD:275368 20/50 (40%)
C2H2 Zn finger 541..561 CDD:275368 6/19 (32%)
zf-H2C2_2 555..581 CDD:290200 10/30 (33%)
C2H2 Zn finger 572..592 CDD:275368 5/24 (21%)
zf-H2C2_2 585..609 CDD:290200 6/23 (26%)
zf-C2H2 598..620 CDD:278523 9/21 (43%)
C2H2 Zn finger 600..620 CDD:275368 9/19 (47%)
zf-H2C2_2 612..637 CDD:290200 13/24 (54%)
C2H2 Zn finger 628..646 CDD:275368 6/17 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446635
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.