DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment D19B and ouib

DIOPT Version :9

Sequence 1:NP_477297.1 Gene:D19B / 38717 FlyBaseID:FBgn0022699 Length:774 Species:Drosophila melanogaster
Sequence 2:NP_649822.2 Gene:ouib / 41039 FlyBaseID:FBgn0037618 Length:312 Species:Drosophila melanogaster


Alignment Length:423 Identity:89/423 - (21%)
Similarity:152/423 - (35%) Gaps:128/423 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IHTVCRTCLSTVDDSAAYDLFRVPG--LAKKLCVCTSLSVEQADGFPKNLCNVCFSKLNDLHDFQ 71
            ::.|||.|........:.:||.:..  ..|.|.:.:.|.:...|..|..:|..|.::|.....|:
  Fly     2 LNIVCRVCGRQKICEKSLNLFDLVNRKYLKHLHMISGLRLVDLDDVPGFMCLCCQAELRSALAFR 66

  Fly    72 KQCVDSVQKFQDLVASNAFACQTNFDVLDTSAAVADLPGEEEDNVHFDPLLNSKIEIIENEEDVF 136
            |.|:.:..|:              ..:.|.|::     |:|:.|.      ||:   :|:|:..|
  Fly    67 KLCIKTQTKW--------------LTIEDDSSS-----GDEDTND------NSE---LESEKCAF 103

  Fly   137 KMLESVEKEVEEVEMEMEQPFGRVSQDDSFESGNDNDLDADFQISSDDDIPLAQRSRRGATRGSK 201
                              ..||:..:.:..|.        .||:..::: |:.:...|.|     
  Fly   104 ------------------SDFGKKKEGELVEE--------TFQVLIEEE-PMDKTLNRDA----- 136

  Fly   202 AKGKPKSAAKRQEEESEESEETSSSDDSDGNPKDKPKRKRIPATERDRHRLIDCHICHQKFKKAI 266
                   .|:.:|:..:|              |..|.:|.|..:.:...::..|.:|........
  Fly   137 -------KAQLREDGIDE--------------KCVPSQKIIKVSTKLDDQIYICELCGTHATSKP 180

  Fly   267 RYEEHMKHHNDLLPFQCTVESCRKGFTTANGLRVHVEHAHTETSAMHPCTYEGCNKSFARPVLLS 331
            .::.||:.|....||.|  :.|...|.:|..||.|                              
  Fly   181 TFQRHMRKHRGERPFGC--KDCDARFLSAGELRAH------------------------------ 213

  Fly   332 FHMKRVHKVDTPQRDFPCTECEKVFRCPTALKKHMYKHTGEELPFACEICGKRFPINSVLRDHLL 396
                  |:|.|.::.|.|..|||.:........|...||.:. |:.||.|||:|....||::|::
  Fly   214 ------HRVHTGEQPFACRFCEKRYVSYMGRLIHERTHTNDR-PYVCEECGKKFTTAYVLKNHMV 271

  Fly   397 RHAGIKNHVCPYCGVGKTTRQEWNK-HILTHTK 428
            .|.|.:|..|..|     .|....| |::|||:
  Fly   272 IHTGERNFRCDIC-----DRSFQRKAHLVTHTR 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
D19BNP_477297.1 zf-AD 12..83 CDD:214871 18/72 (25%)
C2H2 Zn finger 255..275 CDD:275368 4/19 (21%)
C2H2 Zn finger 283..335 CDD:275368 7/51 (14%)
C2H2 Zn finger 318..338 CDD:275368 0/19 (0%)
COG5048 <347..512 CDD:227381 29/83 (35%)
C2H2 Zn finger 349..369 CDD:275368 5/19 (26%)
C2H2 Zn finger 378..398 CDD:275368 9/19 (47%)
C2H2 Zn finger 406..426 CDD:275368 5/20 (25%)
C2H2 Zn finger 434..455 CDD:275368
C2H2 Zn finger 463..483 CDD:275368
C2H2 Zn finger 491..511 CDD:275368
C2H2 Zn finger 586..607 CDD:275368
C2H2 Zn finger 615..635 CDD:275368
zf-H2C2_2 627..652 CDD:290200
C2H2 Zn finger 643..663 CDD:275368
ouibNP_649822.2 zf-AD 5..78 CDD:214871 18/86 (21%)
COG5048 <158..300 CDD:227381 46/186 (25%)
C2H2 Zn finger 169..189 CDD:275368 4/19 (21%)
C2H2 Zn finger 197..217 CDD:275368 8/57 (14%)
zf-H2C2_2 209..234 CDD:290200 11/60 (18%)
C2H2 Zn finger 225..245 CDD:275368 5/19 (26%)
zf-H2C2_2 241..262 CDD:290200 10/21 (48%)
C2H2 Zn finger 253..273 CDD:275368 9/19 (47%)
zf-H2C2_2 266..288 CDD:290200 8/26 (31%)
C2H2 Zn finger 281..299 CDD:275368 7/22 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24388
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.