DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment D19B and nom

DIOPT Version :9

Sequence 1:NP_477297.1 Gene:D19B / 38717 FlyBaseID:FBgn0022699 Length:774 Species:Drosophila melanogaster
Sequence 2:NP_001262384.1 Gene:nom / 41038 FlyBaseID:FBgn0037617 Length:370 Species:Drosophila melanogaster


Alignment Length:440 Identity:88/440 - (20%)
Similarity:150/440 - (34%) Gaps:138/440 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VCRTCLSTVDDSAAYDLFRVPG---LAKKLCVCTSLSVEQADGFPKNLCNVCFSKLNDLHDFQKQ 73
            |||.|..:.....|.:||: ||   :.:::.:.|.:.::|....|..:|..|.:.|.....|::|
  Fly     5 VCRVCGRSRLCPKAVELFK-PGRQDILRRIQLITGILLQQIPNAPDMVCFCCQTDLQSAMIFRRQ 68

  Fly    74 CVDSVQKFQDLVASNAFACQTNFDVLDTSAAVADLPGEEEDNVHFDPLLNSK------------- 125
            |:...:|:..|:.|:....                 .||:.....||....|             
  Fly    69 CILQQKKWVPLLQSDKVGA-----------------SEEKKVEPNDPSTKKKTTKRRRGRPRMPL 116

  Fly   126 --IEIIENEEDVFKMLESVEKEVEEVEMEMEQPFGRVSQDDSFESGNDNDLDADFQISSDDDIPL 188
              ::|:...|......|||..:      |.:||         .|..|:.|       ::|.|:.|
  Fly   117 EIVDIVVTNESKASAGESVGGD------EFDQP---------VEISNEPD-------ATDSDVNL 159

  Fly   189 AQRSRRGATRGSKAKGKPKSAAKRQEEESEESEETSSSDDSDGNPKDKPKRKRIPATERDRHRLI 253
                                      ||.:..:|.....|.|           :|..:  .|:..
  Fly   160 --------------------------EEIDLPDEDGLESDHD-----------LPNVQ--IHKCD 185

  Fly   254 DCHICHQKFKKAIRYEEHMKHHNDLLPFQCTVESCRKGFTTANGLRVHVEHAHTETSAMHPCTYE 318
            .|.|........:|   |...||.:.|:.|  :.|.|.|..|:.|:.|        :..|     
  Fly   186 TCGIIKNNKSSLVR---HQFEHNGIRPYPC--KECPKTFLVASELKAH--------NLTH----- 232

  Fly   319 GCNKSFARPVLLSFHMKRVHKVDTPQRDFPCTECEKVFRCPTALKKHMYKHTGEELPFACEICGK 383
                               |.::.|   |.|..|::.:......|||...||.|. ||.|:.|||
  Fly   233 -------------------HTLEPP---FACRYCDRRYFSVVGRKKHERVHTNER-PFVCDQCGK 274

  Fly   384 RFPINSVLRDHLLRHAGIKNHVCPYCGVGKTTRQEWNKHILTHTKEKKYE 433
            .|....:|:.|:..|..::.:.|..|....:.::....|.:::|.::..|
  Fly   275 AFTRTCILKAHMAVHQVVRKYSCDVCDRSFSLKKHLATHFISNTHKRNAE 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
D19BNP_477297.1 zf-AD 12..83 CDD:214871 19/73 (26%)
C2H2 Zn finger 255..275 CDD:275368 4/19 (21%)
C2H2 Zn finger 283..335 CDD:275368 8/51 (16%)
C2H2 Zn finger 318..338 CDD:275368 0/19 (0%)
COG5048 <347..512 CDD:227381 24/87 (28%)
C2H2 Zn finger 349..369 CDD:275368 5/19 (26%)
C2H2 Zn finger 378..398 CDD:275368 7/19 (37%)
C2H2 Zn finger 406..426 CDD:275368 3/19 (16%)
C2H2 Zn finger 434..455 CDD:275368 88/440 (20%)
C2H2 Zn finger 463..483 CDD:275368
C2H2 Zn finger 491..511 CDD:275368
C2H2 Zn finger 586..607 CDD:275368
C2H2 Zn finger 615..635 CDD:275368
zf-H2C2_2 627..652 CDD:290200
C2H2 Zn finger 643..663 CDD:275368
nomNP_001262384.1 zf-AD 5..76 CDD:214871 18/71 (25%)
C2H2 Zn finger 184..204 CDD:275368 4/22 (18%)
C2H2 Zn finger 212..261 CDD:275368 16/85 (19%)
zf-H2C2_2 255..278 CDD:290200 13/23 (57%)
C2H2 Zn finger 269..289 CDD:275368 7/19 (37%)
zf-H2C2_2 282..305 CDD:290200 5/22 (23%)
C2H2 Zn finger 297..313 CDD:275368 2/15 (13%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24388
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.