DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment D19B and Oaz

DIOPT Version :9

Sequence 1:NP_477297.1 Gene:D19B / 38717 FlyBaseID:FBgn0022699 Length:774 Species:Drosophila melanogaster
Sequence 2:NP_001188929.1 Gene:Oaz / 36609 FlyBaseID:FBgn0284250 Length:1366 Species:Drosophila melanogaster


Alignment Length:744 Identity:153/744 - (20%)
Similarity:228/744 - (30%) Gaps:259/744 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 QTNFDVLDTSAAVADLPGEEEDNVHFDPLLNSKIEIIE---------------NEEDVFKMLESV 142
            |.::...|..||.|.:..|||.....:.|.:.:.|::.               :|||      :|
  Fly    75 QQSWPTADEPAAPAAVAKEEEAEEGSEELQHPRDEVVASDAAANANGHCKSSGHEED------AV 133

  Fly   143 EKEVEEVEMEMEQPFGRVSQDDSFESGNDNDLDADFQISSDDDIPLAQRSRRGATRGSKAKGKPK 207
            :.| |..::|::.....:|.|:.::......||:.:     .|:.....|...:...|.....|.
  Fly   134 DAE-EPEDLELDDELLSLSGDEDYDDEELQSLDSFY-----SDMYSTHTSSSYSPSISDGTMTPN 192

  Fly   208 S-------AAKRQEEESEESEETSSSDDSDGNPKDKPKRKRIPATERDRHRLIDCHICHQKFKKA 265
            |       .|..||:...|.:....:|.     :|.||.||:|......|.    |..||   :|
  Fly   193 SHHLIGAPTAAGQEDHPTEGKINGGADG-----EDLPKPKRLPHFHHHHHH----HYHHQ---QA 245

  Fly   266 IRYEEHMKHHNDLLPFQCTVESCRKGFTTANGLRVHVEHAHTETSAMHPCTYEGCNKSFARPVLL 330
            ::....::..|         :..:.|.|...|       |....|.....|.||..         
  Fly   246 LKIANKLRKIN---------KEAKMGATAGGG-------ATGAASKFDKLTGEGIK--------- 285

  Fly   331 SFHMKRVHKVDTPQRDFPCTECEKVFRCPTALKKHMYKHTGEELPFACEICGKRFPINSVLRDHL 395
                      ......:.|..|||.|.....||.|:..| .|.|||.||.|.|.|........|.
  Fly   286 ----------SRGDGSYQCQFCEKTFPRLGYLKHHVQSH-AEHLPFKCEYCSKLFKHKRSRDRHK 339

  Fly   396 LRHAGIKNHVCPYCGVGKTTRQEWNKHILTHTKEKKYECRQCDHASHNKQALANHVKVVHEK--- 457
            ..|...:|:.||:|....:.......|:.||..:|.::|..|:...:...||.:|:: .|:|   
  Fly   340 KLHTNERNYKCPHCEAAFSRSDHLKIHMKTHDIQKPFQCSMCNRGYNTAAALTSHMQ-KHKKNAA 403

  Fly   458 -----------------------------------------------RKDF-------------- 461
                                                           |.||              
  Fly   404 ILAAGGNPNALNYSPRSTGSASASVSSNGSLQKRRYALALASDSSPSRMDFPKRSRSNHVGGTTT 468

  Fly   462 --------ACQYCGKT--FG-----KSHACKIHERSHT---------GEKC-CECKICGKVFLFE 501
                    .|.||.|.  |.     .:|...:||:..|         ||.. ..|:.|...|...
  Fly   469 TATPTPLLRCSYCPKVTEFSSLEQLNAHLQSVHEQPQTQAVKTPVQEGEGFQLSCEYCTMKFGNI 533

  Fly   502 KGLTKHLK-THEKR--------------------------DLPKTQGTNALMGDGASGSSTIAKP 539
            .||.:|:: ||..|                          ||||                  .||
  Fly   534 AGLFQHMRSTHMDRLSSPNSYYEHFNRLATAGTFSPRLALDLPK------------------IKP 580

  Fly   540 ---SPHLRGRVERVDI-AQLAGTVANPI------------PS------------VNLPSWSPQVN 576
               ||....|....|: ..|:.....|:            ||            ..||.:....|
  Fly   581 DLGSPERESRPAEDDLPTDLSNNKRRPLTPNPQAQTPLAPPSAPPGVFFCNQCNAGLPDFESFRN 645

  Fly   577 FTKK---EG-QHICPDCGKGFNHVSNMKLHYKVVHQKV--KDF-CCRFCPKRFAKKQYLRHH--- 631
            ..|.   || |.:||.||......|..:.|. |.|..:  .:| |...|.|.|||.:.|:.|   
  Fly   646 HLKSHIAEGMQLVCPHCGMSLPEQSEFERHV-VGHFLITGSEFNCSSSCGKSFAKSEDLQQHLLS 709

  Fly   632 EYIHTGEKPYECKVCGKHFRQEQVLKTHM 660
            |::.|..|   |.:|.:.......::.|:
  Fly   710 EHVLTLLK---CSLCSELCESRMAMQLHL 735

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
D19BNP_477297.1 zf-AD 12..83 CDD:214871
C2H2 Zn finger 255..275 CDD:275368 4/19 (21%)
C2H2 Zn finger 283..335 CDD:275368 8/51 (16%)
C2H2 Zn finger 318..338 CDD:275368 2/19 (11%)
COG5048 <347..512 CDD:227381 56/254 (22%)
C2H2 Zn finger 349..369 CDD:275368 8/19 (42%)
C2H2 Zn finger 378..398 CDD:275368 6/19 (32%)
C2H2 Zn finger 406..426 CDD:275368 4/19 (21%)
C2H2 Zn finger 434..455 CDD:275368 5/20 (25%)
C2H2 Zn finger 463..483 CDD:275368 8/26 (31%)
C2H2 Zn finger 491..511 CDD:275368 6/20 (30%)
C2H2 Zn finger 586..607 CDD:275368 7/20 (35%)
C2H2 Zn finger 615..635 CDD:275368 8/22 (36%)
zf-H2C2_2 627..652 CDD:290200 7/27 (26%)
C2H2 Zn finger 643..663 CDD:275368 3/18 (17%)
OazNP_001188929.1 C2H2 Zn finger 294..314 CDD:275368 8/19 (42%)
C2H2 Zn finger 322..342 CDD:275368 6/19 (32%)
zf-H2C2_2 334..359 CDD:290200 6/24 (25%)
COG5048 336..769 CDD:227381 84/423 (20%)
zf-C2H2 348..370 CDD:278523 4/21 (19%)
C2H2 Zn finger 350..370 CDD:275368 4/19 (21%)
C2H2 Zn finger 378..398 CDD:275368 5/20 (25%)
C2H2 Zn finger 630..650 CDD:275368 4/19 (21%)
C2H2 Zn finger 659..679 CDD:275368 7/20 (35%)
C2H2 Zn finger 689..707 CDD:275368 7/17 (41%)
C2H2 Zn finger 1020..1041 CDD:275368
C2H2 Zn finger 1049..1069 CDD:275368
C2H2 Zn finger 1197..1217 CDD:275368
C2H2 Zn finger 1229..1246 CDD:275368
C2H2 Zn finger 1258..1278 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449811
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.