DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment D19B and CG17385

DIOPT Version :9

Sequence 1:NP_477297.1 Gene:D19B / 38717 FlyBaseID:FBgn0022699 Length:774 Species:Drosophila melanogaster
Sequence 2:NP_001286418.1 Gene:CG17385 / 36603 FlyBaseID:FBgn0033934 Length:278 Species:Drosophila melanogaster


Alignment Length:271 Identity:71/271 - (26%)
Similarity:109/271 - (40%) Gaps:59/271 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   227 DDSDGNPKDKPKRKRIPATERDR--HR---------LIDCHICHQKFKKAIRYEEHMKHHNDLLP 280
            |::..|.....:..|...::||:  ||         ..:|.:|.:.|..:...:.|||.|||:.|
  Fly     9 DETVANQFSCKRCDRTFRSKRDQTLHRQEVHNHNKTTYECKLCAKSFCNSGNLDRHMKVHNDVRP 73

  Fly   281 FQCTVESCRKGFTTANGLRVHVEHAHTETSAMHPCTYEGCNKSFARPVLLSFHMKRVHKVDTPQR 345
            |.|.:                                  |:|:||:.|    :::|.:.|.:.:|
  Fly    74 FVCNI----------------------------------CSKAFAQAV----NLQRHYAVHSGER 100

  Fly   346 DFPCTECEKVFRCPTALKKHMYKHTGEELPFACEICGKRFPINSVLRDHLLRHAGIKNHVCPYCG 410
            .|.|..|.|.|...:.:|:|...||||: ||.|:.||:.|.....|:.|.|.|...|.:.|.||.
  Fly   101 PFTCNFCNKSFTQQSNMKRHKMTHTGEK-PFRCQRCGRYFSQLVNLKKHKLGHLNAKPYQCNYCE 164

  Fly   411 VGKTTRQEWNKHILTHTKE-KKYECRQCDHASHNKQALANHVKVVHEKRKDFACQYCGKTFG--- 471
            .|.|....:.:|:.:|.|| ...:......|:   .|||.......:|...|.|..|...|.   
  Fly   165 KGFTQLSNFKRHLQSHIKEGVDVDVPASIQAA---AALARERLESEQKPSFFECMVCRAIFDTFA 226

  Fly   472 --KSHACKIHE 480
              :.|..|.||
  Fly   227 DYEKHEAKCHE 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
D19BNP_477297.1 zf-AD 12..83 CDD:214871
C2H2 Zn finger 255..275 CDD:275368 6/19 (32%)
C2H2 Zn finger 283..335 CDD:275368 6/51 (12%)
C2H2 Zn finger 318..338 CDD:275368 6/19 (32%)
COG5048 <347..512 CDD:227381 44/140 (31%)
C2H2 Zn finger 349..369 CDD:275368 6/19 (32%)
C2H2 Zn finger 378..398 CDD:275368 7/19 (37%)
C2H2 Zn finger 406..426 CDD:275368 6/19 (32%)
C2H2 Zn finger 434..455 CDD:275368 4/20 (20%)
C2H2 Zn finger 463..483 CDD:275368 7/23 (30%)
C2H2 Zn finger 491..511 CDD:275368
C2H2 Zn finger 586..607 CDD:275368
C2H2 Zn finger 615..635 CDD:275368
zf-H2C2_2 627..652 CDD:290200
C2H2 Zn finger 643..663 CDD:275368
CG17385NP_001286418.1 COG5048 <13..181 CDD:227381 54/206 (26%)
C2H2 Zn finger 18..39 CDD:275368 5/20 (25%)
C2H2 Zn finger 48..68 CDD:275368 6/19 (32%)
C2H2 Zn finger 76..96 CDD:275368 7/57 (12%)
C2H2 Zn finger 104..124 CDD:275368 6/19 (32%)
C2H2 Zn finger 132..148 CDD:275368 5/15 (33%)
C2H2 Zn finger 160..180 CDD:275368 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449749
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.