DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment D19B and CG30431

DIOPT Version :9

Sequence 1:NP_477297.1 Gene:D19B / 38717 FlyBaseID:FBgn0022699 Length:774 Species:Drosophila melanogaster
Sequence 2:NP_610211.1 Gene:CG30431 / 35549 FlyBaseID:FBgn0050431 Length:418 Species:Drosophila melanogaster


Alignment Length:474 Identity:125/474 - (26%)
Similarity:184/474 - (38%) Gaps:111/474 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VCRTCL--------STVDDSAAYDLFRVPGLAKKL-CVCTSLSVEQADGFPKNLCNVCFSKLNDL 67
            |||.||        |..|.|:.        ||.:| .:..:|.:|..|.....:|::|..:|:|.
  Fly    11 VCRCCLLEQPPLYHSLYDASSQ--------LAVELKALAPALRLEHGDNLTDVICDLCLRRLHDA 67

  Fly    68 HDFQKQCVDSVQKFQDLVASNAFACQTNFDVLDTSAAVADLPGEEEDNVHFDPLLNSKIEIIENE 132
            .|||::|..|.|           ..:...:....:.||.|....::                   
  Fly    68 RDFQRRCEHSEQ-----------VLRMRHEHWKHTVAVGDALALDD------------------- 102

  Fly   133 EDVFKMLESVEKEVEEVE------MEMEQPFGRVS---QDDSFESGNDNDLDADFQIS--SDDDI 186
                 :||.:|:||..:|      ::..:|...|:   :...|||       .|||.|  |:.||
  Fly   103 -----VLECLEREVGSLEGPMSVPLQASKPVAHVAPLMETVDFES-------LDFQDSSHSEHDI 155

  Fly   187 PLAQRSRRGATRGSKAKGKPKSA---AKRQEEESEESEETSSSDDSDGNPK---DKPKRKRIPAT 245
            |....|...:...:....:|::|   |.......|.|||  .:.|:...||   .:|::..:...
  Fly   156 PSYWESSVDSGSLNTPHHQPETAELFAVEPPTPPESSEE--PAPDAAEKPKMRRARPRQDNVKPK 218

  Fly   246 ERDRHRLIDCHICHQKFKKAIRYEEHMKHHNDLLPFQCTVESCRKGFTTANGLRVHVEHAHTETS 310
            ||             |...|:       |...|.|  |  ..|.|.||....|::|:...|....
  Fly   219 ER-------------KASGAV-------HPRSLHP--C--PECEKKFTRNFQLKLHMTAVHGMGE 259

  Fly   311 AMHPCTYEGCNKSFARPVLLSFHMKRVHKVDTPQRDFPCTECEKVFRCPTALKKHMYKHTGEELP 375
            ..:.|  |.|.|:||....|.:|:|.||..:.|   |.|..|::.|...|.|..|:..||||..|
  Fly   260 MRYQC--EECRKNFASRHSLRYHVKSVHSTERP---FGCQHCDRRFILRTQLLSHLRTHTGEAKP 319

  Fly   376 --FACEICGKRFPINSVLRDHLLRHAG--IKNHVCPYCGVGKTTRQEWNKHILTHTKEKKYECRQ 436
              |.|:.|.|.:|..|.||.|:..|..  .:...|..|.....||...|.|:|.||.||.:.|..
  Fly   320 RIFECQRCSKSWPTKSDLRTHMRSHNPNMERPFKCDRCSKAFFTRGHLNSHLLVHTGEKPFACEY 384

  Fly   437 CDHASHNKQALANHVKVVH 455
            ||....:...|.||:..:|
  Fly   385 CDKCYQSVGNLNNHMVRLH 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
D19BNP_477297.1 zf-AD 12..83 CDD:214871 24/79 (30%)
C2H2 Zn finger 255..275 CDD:275368 2/19 (11%)
C2H2 Zn finger 283..335 CDD:275368 16/51 (31%)
C2H2 Zn finger 318..338 CDD:275368 8/19 (42%)
COG5048 <347..512 CDD:227381 40/113 (35%)
C2H2 Zn finger 349..369 CDD:275368 6/19 (32%)
C2H2 Zn finger 378..398 CDD:275368 8/19 (42%)
C2H2 Zn finger 406..426 CDD:275368 7/19 (37%)
C2H2 Zn finger 434..455 CDD:275368 6/20 (30%)
C2H2 Zn finger 463..483 CDD:275368
C2H2 Zn finger 491..511 CDD:275368
C2H2 Zn finger 586..607 CDD:275368
C2H2 Zn finger 615..635 CDD:275368
zf-H2C2_2 627..652 CDD:290200
C2H2 Zn finger 643..663 CDD:275368
CG30431NP_610211.1 zf-AD 11..82 CDD:285071 24/89 (27%)
C2H2 Zn finger 234..255 CDD:275368 7/22 (32%)
C2H2 Zn finger 264..285 CDD:275368 9/22 (41%)
C2H2 Zn finger 293..313 CDD:275368 6/19 (32%)
zf-C2H2_8 305..373 CDD:292531 23/67 (34%)
C2H2 Zn finger 324..344 CDD:275368 8/19 (42%)
C2H2 Zn finger 354..374 CDD:275368 7/19 (37%)
zf-H2C2_2 366..389 CDD:290200 10/22 (45%)
C2H2 Zn finger 382..403 CDD:275368 6/20 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446637
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.